Informations

Pourquoi la protéinase K ne se dégrade pas ?

Pourquoi la protéinase K ne se dégrade pas ?


We are searching data for your request:

Forums and discussions:
Manuals and reference books:
Data from registers:
Wait the end of the search in all databases.
Upon completion, a link will appear to access the found materials.

Quelqu'un peut-il me dire pourquoi la protéinase K ne se dégrade pas ?

Si possible merci de m'indiquer la source.


Selon invitrogen, la protéase K subit une autolyse, mais certains fragments restants ont encore une activité de protéase. La solution doit être conservée à -20C, cette basse température est probablement le meilleur moyen d'éviter l'autolyse. Si vous utilisez l'enzyme pour digérer les protéines à 37 °C, vous devrez simplement gérer la perte de la protéinase k pendant la réaction et vous assurer d'en ajouter suffisamment pour détruire la protéine cible avant que la protéinase ne soit épuisée.


La protéinase K est sensible à l'autolyse. L'enzyme est stabilisée par la présence d'ions calcium (qui se lient à la protéine). L'absence de calcium favorise l'autolyse de l'enzyme et réduit également la demi-vie de l'activité enzymatique. La raison la plus probable pour laquelle la plupart des chercheurs ne remarquent jamais un effet substantiel de l'autolyse est que cela prend environ 48 heures pour être remarqué, alors que la plupart des digestions de protéinase K ne prennent que quelques heures. Pour plus de détails, lisez le document suivant :


Immunoprécipitation

Notes sur l'immunoprécipitation

L'immunoprécipitation (IP) est utilisée pour séparer les protéines liées à un anticorps spécifique du reste d'un échantillon, tandis que la co-IP est utilisée pour identifier les interactions protéine-protéine entre la protéine qui s'est liée à l'anticorps utilisé pour l'IP et des protéines supplémentaires qui sont détectés par immunoblot. Il agit en liant des anticorps à la protéine A, à la protéine G ou à un mélange des deux créé en laboratoire appelé protéine A/G. Les protéines A et G sont des protéines bactériennes qui se lient très bien aux anticorps. Les protéines A et G se lient différemment aux anticorps de différentes espèces, vous pouvez donc consulter un tableau pour identifier quelle protéine fonctionnera le mieux pour vous, ou vous pouvez simplement commander la protéine A/G (ce n'est pas beaucoup plus cher, voire pas du tout) . Ces protéines sont liées à des billes d'agarose (ou à des variantes brevetées) pour leur donner du poids. L'idée de base est que vous incubiez votre anticorps IP avec les billes d'agarose conjuguées à la protéine A/G (certains laboratoires appellent ces billes des « bugs »), puis incubez votre échantillon de solution protéique avec le complexe anticorps-bille d'agarose. Vous centrifugez ensuite l'échantillon à basse vitesse et le complexe protéique lié aux billes et à l'anticorps formera un culot que vous pourrez séparer du surnageant et remettre en suspension dans une autre solution. Félicitations, vous avez effectué une IP. Si vous souhaitez effectuer une co-IP, vous prenez votre produit IP (collecte des protéines dans un tampon de lyse très doux pour préserver les complexes protéiques), exécutez SDS-PAGE et effectuez des immunoblots avec des anticorps qui ciblent les protéines qui, selon vous, interagissent avec votre produit IP. protéine(s). Les contrôles IP sont similaires aux contrôles immunoblot, sauf qu'il est vraiment utile d'avoir deux anticorps qui partagent la même cible, de sorte que vous pouvez immunoprécipiter avec un, et sonder un immunoblot avec les deux (si l'IP était vrai, alors les deux anticorps coloreront le mêmes bandes). Encore une fois, le livre Abcam Protocol est une excellente ressource, tout comme le Thermo Scientific Tech Tip #64. Notez que la co-IP est différente du transfert Far-Western, en ce sens que le transfert Far-Western examine les interactions protéine-protéine (comme le co-IP) mais utilise une protéine "appât" étiquetée pour éliminer les protéines en interaction, au lieu d'utiliser des anticorps.

Il ne faut pas oublier que l'IP, l'immunotransfert et l'immunohistochimie sont considérés comme trois techniques différentes pour une raison. IP a des conditions expérimentales différentes de l'immunotransfert, les deux sont différentes de l'immunohistochimie, et ces trois sont différentes des ELISA (non couvertes dans ce livre) fondamentalement, certains anticorps fonctionnent pour une ou plusieurs applications, et un anticorps qui fonctionne pour toutes les applications est extrêmement rare (je ne suis pas sûr qu'il en existe !). De plus, les IP dépendent à la fois de la capacité de votre anticorps primaire à se lier à la bonne protéine et de la capacité de l'anticorps à se lier à la protéine A/G, donc si l'une de ces deux choses ne se produit pas, vous n'obtiendrez pas de données.


Des questions

Question : Pourquoi n'arrêtez-vous pas la réaction de la protéinase K avec la glycine ?
UNE: Je pense que la glycine inhibe l'enzyme et arrête la digestion immédiatement. Je ne sais pas quand ni pourquoi cette étape a été supprimée du protocole que j'utilise, mais les lavages répétés en PBT accomplissent la même chose plus progressivement. Dans les différents protocoles que j'ai vus, les gens utilisent une très large gamme de concentrations finales de ProtK (de 4 à 50 µg/ml) et de temps d'incubation (1 à 10 minutes). En général, il semble qu'une concentration plus élevée s'accompagne d'un temps d'incubation plus court et de l'utilisation d'un tampon à la glycine pour arrêter la réaction : si le temps de réaction est court, la marge d'erreur est plus petite et vous aurez plus de contrôle sur l'arrêt de la digestion à la temps précis en utilisant la glycine. Avec une concentration plus faible et un temps d'incubation plus long, le moment de l'arrêt de la digestion n'est pas si critique et l'élimination progressive de l'enzyme avec des lavages répétés est OK.

Question : À propos de la protéinase K : différents fabricants produisent des ProtK qui diffèrent par la quantité d'unités d'activité/mg. Auparavant, j'utilisais des unités/ml plutôt que des mg/ml. Avez-vous déjà fait attention à cela, ou pensez-vous que ce n'est pas fiable?
UNE: Peu importe ce que vous utilisez, unités ou mg par ml, tant que vous savez quelle est l'activité pour cette application. Leurs « unités » ne mesurent pas l'activité de digestion sur des Drosophile embryons et vous devez découvrir les conditions de performance optimales de votre propre stock de ProtK grâce à des tests. D'un autre côté, ces unités vous donneront une bonne estimation du point de départ du titrage de votre propre stock si vous passez d'une marque à l'autre ou si vous composez un nouveau lot. Un dernier commentaire sur l'utilisation de ProtK : il augmente définitivement le niveau de signal absolu de vos taches, ainsi que réduit le bruit de fond. Cela en vaut la peine.

Question : Pourquoi n'utilisez-vous pas la PCR pour générer vos modèles de sonde ? De cette façon, vous n'avez pas besoin de faire grandir beaucoup d'ADN plasmidique.
UNE: Parce que je suis désespérément démodé et que je ne sais pas vraiment comment faire de la PCR. Roche propose un protocole PCR pour la fabrication de sondes marquées, que de nombreuses personnes utilisent, et le projet d'expression génique BDGP utilise un protocole PCR pour sa coloration d'embryons à haut débit. Je fais des préparations midi Qiagen pour purifier de bonnes quantités de plasmides d'ADNc propres. Quelle que soit la manière dont vous aimez faire la sonde, effectuez un contrôle qualité, comme faire passer le produit de la réaction sur un gel, pour vous assurer que la réaction s'est bien passée, ou en détecter une tache sur une membrane, pour vérifier le degré de marquage.

Question : Pourquoi n'utilisez-vous pas le ddH traité au DEPC2Oh ? C'est pas cher et facile à faire.
UNE: Je ne l'utilise pour aucune partie de la coloration des embryons car je n'ai aucun problème à obtenir beaucoup de signal et je suppose donc que je n'ai aucune dégradation significative des sondes après leur hybridation avec les embryons. Si vous avez un problème de contamination par la RNase dans votre ddH2O approvisionnement en eau, alors, par tous les moyens, vous devez vous battre. De plus, je préfère le ddH non traité au DEPC, filtré et certifié sans nucléase.2O dans les réactions de synthèse de la sonde parce que j'ai entendu dire que même la plus petite quantité de DEPC résiduel peut avoir un impact négatif sur la polymérase. Superstition? Probablement, mais 1 L d'eau sans RNase de fantaisie, assez pour synthétiser environ 50 000 sondes, coûte le même prix que 5 ml de DEPC et vous n'avez pas non plus à traiter le ddH2toi-même.

Question : Pourquoi fragmentez-vous vos sondes ? J'ai entendu dire que vous n'êtes pas obligé de le faire et aggrave en fait les sondes dans certains cas.
UNE: Je ne revendique aucune autorité sur ce point, mais je sais ce que j'ai essayé et les résultats que j'ai obtenus. J'essaie des expériences dans lesquelles des sondes pleine longueur non hydrolysées sont nécessaires et je constate qu'elles posent de terribles problèmes de fond. Les mêmes sondes hydrolysées ne donnent aucun bruit de fond. Je commence à avoir l'impression que quelque part entre une taille de sonde de 0,5 à 1 ko, la fragmentation devient nécessaire. Ainsi, certaines des opinions divergentes sur ce point, fragmenter ou ne pas fragmenter, pourraient être dues à des expériences avec différentes tailles de sonde. J'ai également entendu dire qu'il existe une taille de sonde moyenne optimale pour détecter CHAQUE transcrit de gène. Pourquoi pas?

Question : Parfois, après les étapes d'hybridation, j'obtiens de gros amas d'embryons qui ne se brisent jamais. Pourquoi?
UNE: Je suis presque sûr que c'est dû à un traitement excessif à la protéinase K. Quelqu'un d'autre m'a déjà posé des questions sur ce problème, et apparemment après avoir modifié ses conditions de digestion ProtK, le problème a disparu. Je n'ai aucune idée de la raison pour laquelle cet agglutination se produit, et c'est vraiment horrible de le voir arriver à de précieux embryons.

Question : C'est une étape d'hybridation très longue, je ne fais normalement que 12-18 heures. Êtes-vous sûr de la qualité du in situ augmente tellement avec ces heures supplémentaires?
UNE: Dans 50 % de formamide, il faut beaucoup de temps aux sondes pour s'équilibrer avec leurs cibles appropriées, tout en étant empêchées de former des hybrides stables avec leurs cibles de mésappariement. Plusieurs personnes à qui j'ai parlé à ce sujet ont confirmé que des temps d'hybridation plus longs ont considérablement amélioré les performances des sondes qui donnaient auparavant des taches faibles. Dans ces cas, le temps d'hybridation a été prolongé d'une nuit (

36-40 heures). J'ai vu une référence où ils sont allés jusqu'à trois nuits en essayant de détecter des transcriptions très peu abondantes ! Je n'ai pas testé moi-même une série chronologique. Actuellement, mes embryons sortent avec un très bon signal à 20-24 heures, et aussi avec une très bonne morphologie. Je ne suis pas sûr, mais il semble que l'hybridation des deux pendant la nuit les rend plus doux et plus susceptibles de se déformer sur la diapositive. Après tout, nous cuisons une structure tissulaire protéinée pendant longtemps dans un dénaturant puissant.

Question : Qu'en est-il de votre température d'hybridation à 55 °C ? Pourquoi si bas ? Je fais in situs à 65° C.
UNE: La monture entière d'origine non radioactive in situ La technique d'hybridation, décrite en 1989 par Tautz et Pfeifle, utilisait des sondes ADN marquées et des conditions d'hybridation très proches de celles utilisées dans les années 1980 pour les hybridations ADN : filtre ADN : 50 % formamide et 45°C. Dans l'embryon, les hybrides ADN : ARN étaient formé et ces conditions fonctionnaient. Peu de temps après, les gens ont commencé à utiliser des sondes d'ARN, et la règle empirique, que pour une séquence donnée, la température de fusion de l'hybride ARN:ARN était de 10 °C supérieure à celle de l'hybride ADN:ADN correspondant, a probablement été utilisée pour établir le 55 °C. C. température pour les sondes d'ARN. Je ne sais pas exactement pourquoi ou quand les gens ont commencé à utiliser des températures plus élevées (60 ° C et plus), mais je soupçonne que c'était en réponse à des problèmes de coloration de fond inacceptablement élevée causée par le collage non spécifique de sondes sur les embryons . J'hybride des embryons à 55 ° C depuis longtemps sans problème, et les problèmes de fond que j'ai rencontrés en essayant ces méthodes fluorescentes sont uniquement dus aux réactifs de détection primaires, et non aux sondes, selon mes contrôles.


SOJ Biochimie

Les fantômes microbiens (MG) sont un nouveau terme qui décrit les microbes évacués et morts. Apparemment, les MG pourront (bientôt) substituer un autre terme aux "fantômes bactériens (BG)". Un nouveau protocole de préparation des MG a été introduit en utilisant la concentration ou les quantités critiques de certains composés chimiques et enzymes. En principe, tout composé tel que le SDS et le NaOH ou une enzyme telle que le lysozyme et la protéinase K qui pourraient induire un ou plusieurs pores dans la paroi cellulaire microbienne pourrait être utilisé. "Évacologie" pourrait être le nom d'une nouvelle science qui traite de l'évacuation des cellules vivantes et des virus. De plus, la concentration biocritique de H2O2 active la préparation des Virus Ghosts (VG). Le bactériophage E lyse protocole basé sur les gènes est limité uniquement aux bactéries gram-négatives. Le protocole Sponge-like Protocol (SL) a ouvert la voie à presque tous les microbes et toutes les cellules biologiques et virus à préparer en tant que fantômes. Dans ce point de changement, cette revue vise à couvrir les informations les plus importantes sur un tel sujet. Le protocole SL est basé sur la détermination de la concentration critique de composés qui peuvent tuer, faire des pores, évacuer les cellules, mais n'ont pas déformé ou affecté la paroi cellulaire ou leurs antigènes (sous une telle concentration). Le lysozyme a été utilisé dans le protocole d'origine pour compléter toute carence entraînant la survie de l'un des E. coli cellules. Les lysozymes et les proteinas K peuvent être autonomes ou peuvent être combinés avec les autres composés chimiques possibles. Le protocole SL pour la préparation des fantômes est simple, peu coûteux, en interne, fiable, sûr et provoque des pores de l'extérieur des cellules vers leur intérieur. L'avenir montrera un intérêt croissant avec un protocole aussi simple, qui pourrait nous permettre de préparer notre formule de vaccin et d'administration de médicaments pour différents fantômes en cuisine. Dans ce document, passez en revue la plupart des expériences acquises lors de la pratique d'expériences dans la préparation des fantômes et quelques idées sur un tel sujet ont été résumées et discutées.

Mots clés: Fantômes bactériens Fantômes microbiens Fantômes biologiques Protocole Sponge-Like Gène de lyse du bactériophage E

Comme toute créature, chaque microbe a un cycle de vie, qui se termine par la mort. Les parois cellulaires des microbes après leur mort pourraient rester plus longtemps et résister à la décomposition [4-7]. Cependant, en raison du processus de dégradation naturelle, de l'effet environnemental, de l'activité enzymatique d'autres microbes ou de tout autre mécanisme attendu pour la formation d'un ou plusieurs pores, une perte naturelle du cytoplasme ou, en d'autres termes, une image fantôme microbienne naturelle se produira. En tant que partie de la nature, les microbes après leur mort sont affectés par leur environnement écologique environnant. Pour cela, des fantômes cellulaires et des fantômes microbiens sont produits quotidiennement dans notre corps (à l'intérieur, ou à l'extérieur). Ils sont produits dans les poumons, dans l'estomac, à la surface de notre peau, dans nos aliments vieillis, etc. Par conséquent, les microbes morts et fantômes sont des phénomènes naturels.

De plus, ils jouent des rôles différents dans la vaccination. Le phénomène de fantôme naturel dans notre corps joue un rôle important dans la vaccination. Les aliments vieillis utilisés par l'ancienne civilisation pourraient avoir été utilisés à des fins de vaccination. L'Égyptien ancien a inventé un certain type de fromage nommé vieux fromage ou Mish (Mesh) qui combine le fait d'être si vieux que si un microbe nocif existe en tant que contaminant, il est soit atténué, soit mort. Un tel vieux fromage ou fromage Mish/Mesh pourrait être inventé non seulement comme un type de fromage, mais pour protéger l'Égyptien de nombreuses maladies.

La protéine de lyse ϕX174 E provoque une structure tunnel transmembranaire spécifique à E construite à travers le complexe d'enveloppe cellulaire [24-27]. Il forme une fusion à travers les membranes cellulaires interne et externe, formant une structure tunnel transmembranaire spécifique. À travers un tel tunnel ou pore, le contenu cytoplasmique bactérien s'évanouit. Les outils de génie génétique et de biologie moléculaire permettent un meilleur contrôle du protocole basé sur le gène de lyse du bactériophage E.

L'enzyme de lyse produite permet aux pores de la paroi cellulaire bactérienne. Il existe encore un besoin de dégrader le résidu de l'ADN, du plasmide, des lysozymes, de la protéinase K... qui contaminent encore les cellules bactériennes ouvertes.

E lyse gène, son activité est limitée aux seules bactéries gram-négatives. Le gène E a été cloné et exprimé dans différents hôtes gramnégatifs. Une telle expression a été contrôlée par un promoteur thermosensible, qui permet l'expression de la E lyse gène. L'utilisation du promoteur et du régulateur thermosensibles a été utilisée pour un meilleur contrôle. Néanmoins, son principal point faible est qu'il se limite aux seules bactéries gram-négatives [4, 28].

Gène E : La teneur en acides aminés de la séquence de protéine de lyse E du phage EnterX174 d'entérobactéries et sa teneur en nucléotides ont été bien identifiées (comme ci-dessous). On peut obtenir de l'ADN de phage non coupé sur le marché et cloner le gène de lyse E. Alternativement, on peut isoler le phage et effectuer un isolement d'ADN puis cloner le gène de lyse E ou le couper avec une enzyme appropriée et constituer une banque de gènes.

E lyse séquence de nucléotides du gène :
atggtacgctggactttgtgggataccctcgctttcctgctcctgttgagtttattgctgccgtcattgcttattatgttcatcccgtcaacattcaaacggc ctgtctcatcatggaaggcgctgaatttacggaaaacattattaatggcgtcgagcgtgtgtccagctagcttaccgcgcgattgaattgcgaggactagagctacggaaaacattattaatggcgtcgagcgtgtgtccagctagcttaccgcgcgattgaattgcgaggactaggctagtacggaaaacattattaatggcgtcgagcgtgtgtccagtagcttaccgcgattgagt

Séquence d'acides aminés :
MVRWTLWDTLAFLLLLSLLLPSLLIMFIPSTFKRPVSSWKALNLRKTLLMASSVQLKPLNCSRLPCVYAQET LTFLLTQKKTCVKNCVQKE

Un pore suffit ! : Une formation de pores dans les parois cellulaires des microbes entraînera l'élimination du cytoplasme qui sortira en raison de la force de pression déséquilibrée de la paroi cellulaire, des différences d'osmose, de la pression mécanique, etc. Le milieu externe peut diffuser à travers le tunnel de lyse remplissant la cellule interne l'espace des BG encore rigides [27]. Apparemment, et après avoir observé de nombreuses images au microscope électronique, un seul pore existe généralement. Cela pourrait être dû à la force résultant de l'existence du premier pore. Lorsque le premier pore est ouvert, le déséquilibre de la pression interne entraîne l'élimination du contenu du cytoplasme et du reste de la protéine de lyse E, de sorte qu'il n'y a aucune chance de former un autre pore [29].

Antigène de surface étranger et administration de médicament : Les cellules fantômes peuvent être réalisées après l'expression d'un antigène étranger, le chargement de médicaments, d'ADN, de plasmide, etc. dans les cellules. Cependant, en cas d'utilisation de MG dans l'administration du médicament, après un tel chargement dans le médicament, le pore existant doit être fermé ou, en termes plus précis, doit être scellé [30]. Récemment, une autre tactique a été introduite où Saccharomyces cerevisiae les fantômes cellulaires ont été chargés avec de l'acide gossypol acétique fantôme dissous, puis on a laissé les fantômes dissous gossypol acétique cristalliser à l'intérieur des cellules de levure. Cela donnera la possibilité de charger des médicaments sans sceller les cellules.

Le protocole SL introduit l'idée d'utiliser la concentration critique de composés chimiques et récemment d'enzymes pour la préparation des fantômes. Les étapes utilisées ont été choisies précieusement pour que les étapes successives permettent une évacuation complète des microbes ou cellules traités de leur contenu cytoplasmique. L'avenir pourrait montrer des composés chimiques plus parfaits ou une forte modification du protocole, mais la reconnaissance devrait être accordée aux six composés chimiques utilisés à l'origine. Ce sont NaOH, SDS, CaCO3, H2O2, NaCl et Ethanol. Récemment NaHCO3 a été utilisé à la place du CaCO3 pour produire des fantômes de levure. H2O2 a été le seul à dégrader l'ARN de Newcastle en utilisant une concentration biocritique. Les enzymes, qui peuvent affecter la paroi cellulaire microbienne, telles que le lysozyme et la protinase k, sont en cours d'optimisation pour donner les mêmes résultats que le protocole SL [données non présentées] mais les composés chimiques sont plus rentables et omettent le risque d'immunisation incorrecte en raison de la utilisation d'enzymes de nature protéique [31]

L'idée principale du protocole SL : L'idée principale du protocole SL est simple et applicable, elle dépend de la détermination de la concentration minimale d'inhibition (MIC) et de la concentration minimale de croissance (MGC) des composés ou enzymes utilisés. L'effet destructeur minimum en cas d'utilisation de MIC des composés ou enzymes utilisés, ils devraient provoquer un effet minimum sur les cellules mortes.En cas de MGC, les cellules sont encore en vie. Cependant, en utilisant un autre MIC/MGC pour le(s) autre(s) composé(s) plus l'effet physique des étapes de centrifugation répétées, tout cela conduira à des cellules mortes vides mais avec une structure 3D correcte et des antigènes de surface corrects qui permettent une immunisation correcte lors de l'utilisation de les animaux de laboratoire. Le protocole SL donne la possibilité de préparer des fantômes à partir de bactéries gram-positives et gram-négatives, de levures et de virus, etc. Un tel concept pourrait être de transmettre les microbes à toute autre forme cellulaire biologique. De nombreuses autres formes issues du système biologique rejoindront la famille fantôme après leur préparation par ce protocole (concentration chimique critique) prochainement.

L'utilisation d'une concentration chimique critique pour la destruction microbienne est un phénomène naturel: P. aeruginosa est un microbe dominant dans les hôpitaux alors qu'il s'agit – en un mot – de microbes hydrocarbures biodégradables. H2O2 pourrait transformer n'importe quel P. aeruginosa à la souche mucoïde donc au producteur d'alginate. P. aeruginosa est capable d'être muté et de produire une énorme quantité d'exopolysaccharide, principalement l'alginate s'il est exposé au H2O2. Cela pourrait également se produire dans les poumons des patients. En tant que mécanisme de défense contre les P. aeruginosa infection produite par le poumon H2O2. Comment les cellules pulmonaires pourraient-elles ajuster la quantité de H2O2 tuer le P. aeruginosa mais pas pour tuer leurs propres cellules ? En général, la cellule pulmonaire doit produire (d'une manière ou d'une autre) H2O2 en concentration critique pour tuer ces microbes et ne pas endommager ou tuer ses propres cellules [32]. Pour l'une ou l'autre fin, certains des P. aeruginosa les cellules n'ont pas été tuées par la dose destructrice du H2O2, mais ont été exposés à la place à moins de quantités de H2O2 par l'un ou l'autre mécanisme. Moins de quantité de H2O2 induira un mutant mucoïde. De tels mutants sont capables de produire une énorme quantité d'exopolysaccharide. A partir de tels phénomènes naturels, on peut comprendre quelques faits sur notre "système biologique" et comment il pourrait utiliser intelligemment le concept de "concentration chimique critique". Qui comprend:

1. Notre système biologique sait produire des composés chimiques à des concentrations critiques.

2. Des concentrations inférieures à la CMI pourraient provoquer des mutations, où de telles concentrations pourraient maintenir les agents pathogènes affectés mais vivants.

3. Les composés produits par notre système biologique tels que les oxydants et les radicaux libres, en particulier ceux qui produisent pour contrôler les agents pathogènes, devraient être davantage concernés.

4. Une mauvaise utilisation des antioxydants pourrait détériorer notre mécanisme de défense oxydant endogène. Pour cela, les antioxydants doivent être pris à bon escient.

5. Le système biologique prouve toujours qu'il est conçu de manière parfaite et intelligente, les mécanismes utilisés par un tel système doivent donc être prioritaires.

6. Les lysozymes, les protéases, les DNases et autres enzymes naturelles qui font partie de notre système de défense devraient être davantage préoccupés par la recherche de mécanismes plus intelligents pour contrôler ces agents pathogènes.

7. Le composé actif peut être utilisé lors de la dilution pour réduire au minimum les effets secondaires.

El-Baky et Amara (2014) combinent de tels phénomènes et l'idée du protocole SL pour in vitro dégrader l'ARN du virus de Newcastle pour le transformer en fantômes, qui pourraient être optimisés pour être in vivo protocole pour contrôler certains agents pathogènes sans nuire à notre système biologique [3].

Les MG omettent le facteur de virulence le plus important : Lorsque des microbes étrangers pénètrent dans notre corps, notre système immunitaire commence à réagir avec lui et la bataille se basera sur leur nombre, leur type et la qualité de notre système immunitaire. Cependant, certains microbes ont des facteurs de virulence supplémentaires, qui pourraient être collectivement plus forts que notre système immunitaire. Alors, même si nous sommes assez forts, le microbe peut être mortel et dépasser la vitesse de notre système immunitaire. De telles conditions causent la mort ou une maladie ou un trouble grave. Pour cela, les scientifiques préparent des microbes tués ou atténués pour être sûrs que le système immunitaire gérera la situation et contrôlera l'invasion. De tels microbes in/moins actifs donnent à notre système immunitaire la chance et le temps de réagir avec lui. Cependant, de nombreux rapports prouvent que les microbes atténués peuvent être transformés en microbes virulents dans certaines conditions.

Pour cela, les scientifiques ont consacré du temps à réduire les facteurs de virulence des souches pathogènes ou à trouver des solutions alternatives. Ces solutions alternatives peuvent être résumées comme suit :

1. La culture répétée, en milieu, n'a pas maintenu les facteurs de virulence du microbe.
2. Vieillissement cellulaire.
3. Les virus peuvent être cultivés dans un hôte non spécifique, ce qui induit des mutants plus sûrs.
4. L'utilisation de souches recombinantes permet d'exprimer le(s) antigène(s) de certains microbes pathogènes à la surface de leur paroi cellulaire.
5. Des agents pathogènes génétiquement modifiés avec des facteurs de virulence moins ou complètement désactivés peuvent être utilisés.
6. Des souches sûres pourraient induire des anticorps qui peuvent protéger contre certains agents pathogènes de virulence.
7. On utilise des espèces proches capables d'induire une immunisation contre certains pathogènes ciblés.
8. Utilisation des MG (Figure 3).
9. Microbes totalement tués mais avec un nombre approprié d'antigènes de surface efficaces (certains processus de destruction affectent gravement l'antigène de surface des microbes).
Après cela, notre système immunitaire produit les anticorps appropriés. Et préparez-vous à tout envahisseur pathogène.

Les MG sont vraiment des cellules mortes et elles ne pourraient pas se répliquer. Pour cela, s'ils sont pathogènes ils perdront la chance de gagner la bataille contre notre système immunitaire (en augmentant leur nombre). Pour cela, ils sont de parfaits candidats pour activer en toute sécurité notre système immunitaire. Les civilisations anciennes ont pris conscience par les connaissances et les outils de la vaccination. Ils savent vacciner contre la variole, la maladie qui tue des millions de personnes. Ils utilisent une légion virale infructueuse de la variole pour les patients non infectés par le vaccin. Le nom original de la vaccination est variolation ou inoculation. Même de tels rapports prouvent que l'idée principale a été transférée dans le nouveau monde, seulement après avoir amélioré une méthode du Moyen-Orient et d'Afrique, connue sous le nom de ventilation. Nous utilisons encore -jusqu'à aujourd'hui- la même vieille technique. Ces outils simples ont sauvé la vie d'un nombre inconnu de personnes. C'est une pratique africaine qui est transférée en Amérique vers 1706-1721 par un esclave soudanais [33]. Cependant, cela pourrait être un changement dans le concept lorsque la variole a été utilisée à la place de la variole pour immuniser complètement contre cette dernière.

Quelques inquiétudes concernant notre système immunitaire : Il y a quelques points qui devraient être considérés pour ceux qui sont impliqués dans la bataille du contrôle des agents pathogènes. Certaines de ces préoccupations importantes

les préoccupations peuvent être résumées comme suit :

1. Notre système immunitaire est actif à certains âges et moins actif à un autre. Pour cela, nous devons être vaccinés au bon moment.

2. Cependant, en cas d'utilisation de cellules mortes comme les BG, l'équation est différente. Les types de vaccins et la voie d'administration sont une question importante. Système immunitaire faible, devrait donner une heure correcte, la formule (microbes morts/atténués), le site d'administration et ainsi de suite. Les MG ont même des cellules mortes vides, mais elles ont toujours la structure 3D correcte, de sorte que le système immunitaire réagit avec presque la même puissance lorsqu'il attaque des cellules vivantes. Mais il faut considérer le nombre correct de cellules utilisées. Pour cela, une vaccination meilleure et plus sûre a été signalée en cas d'utilisation des MG, en particulier pour la vaccination.

3. On pourrait prendre la dose maximale de MG en toute sécurité alors qu'il s'agit de cellules mortes.

4. Le génie génétique et les outils de biologie moléculaire permettent d'introduire ou d'exprimer la protéine des microbes mortels à la surface de microbe(s) recombinant(s) sûr(s). Après cela, les microbes se sont transformés en fantômes et sont devenus morts et en sécurité.

5. Les BG peuvent être administrés en toute sécurité dans une nouvelle racine d'administration telle que nasale ou à la surface de la peau blessée.

6. En tant qu'ensemble biologique parfait ciblé par différentes cellules immunologiques, en particulier le macrophage, ils deviennent le meilleur choix pour la thérapie génique. Le BGS a augmenté notre compréhension de certains facteurs biologiques tels que notre compréhension de la résistance où les cellules d'apport (mais pas mortes) pourraient acquérir un nouveau matériel génétique les a fait survivre. Alternativement, avant de perdre leur contenu dans certaines conditions, ils pourraient s'hybrider avec d'autres MG.

7. Les microbes exopolysaccharides pourraient donner une fausse CMI où certains microbes survivent en raison de la formation de biofilm. Pour cela, il est recommandé de tuer les microbes, qui peuvent être affectés ou mutés par les composés chimiques utilisés, par NaOH en utilisant sa concentration MIC d'abord H2O2, le SDS peut induire la production d'exopolysacchaide. Comme les autres conteneurs similaires vides, les MG ont une taille plus respective et une enveloppe stable et peuvent être utilisés dans le domaine de l'administration de médicaments.

8. Les BG peuvent être utilisés dans le kit de diagnostic comme antigène de référence, où ils devraient donner une réaction positive avec du sérum contenant les anticorps appropriés [34].

9. Les BG seront dans leur meilleure forme après avoir retiré leur contenu cytoplasmique, y compris l'ADN, l'ARN, la protéine, etc.

Le protocole peut utiliser soit les composés chimiques introduits ou les enzymes en quantités critiques, soit la combinaison des deux. Le protocole SL original et ses formes réduites et modifiées réussissaient à préparer des BG à partir de gram-négatif, gram-positif, levure et virus jusqu'à nos jours. En effet, le concept du protocole permet de préparer des fantômes à partir de n'importe quel microbe ou même de n'importe quelle cellule biologique. C'est parce qu'il est basé sur certains. Les critères uniques pour les composés chimiques ou les enzymes de M. ont été sélectionnés en fonction de leur capacité à tuer les microbes et à induire des pores dans leurs parois cellulaires, à dégrader/ou éliminer leur ADN, leur ARN et la protéine. Les composés ont été utilisés dans des concentrations permettant l'induction d'un effet minimal sur la paroi cellulaire et le protocole lui-même utilise des paramètres physiques pour se débarrasser du cytoplasme tels que l'agitation et la pression des cellules par centrifugation. Pour cela, on lui donne le nom de protocole SL. Le lysozyme et les protéines K qui sont capables de lyser la plupart des types de microbes différents donneront une autre chance d'améliorer un protocole commercial pour la préparation des fantômes. En fait, la plupart des biologistes moléculaires ont utilisé de telles enzymes pour préparer l'ADN à partir de divers microbes. Seulement, ils ont besoin d'être utilisés dans des activités critiques permettant la préparation des fantômes plutôt que la lyse des microbes.

Les premiers composés chimiques utilisés : Les composés sélectionnés, qui ont été utilisés pour préparer les BG en utilisant le protocole SL, sont NaOH, SDS, CaCO3, et H2O2 et à la fois NaCl et Ethanol sont inclus. Le lysozyme et la protéinase K lors de leur utilisation en quantité critique donnent également les mêmes résultats. Certains facteurs physiques sont impliqués (centrifugation, agitation et température). Les paramètres biologiques jouent un rôle central dans la réussite du protocole comme le type de cellule utilisée ou le microbe et leur âge. Les conditions de préparation des fantômes sont des facteurs efficaces. Tels que la densité des cellules lors de la préparation. La qualité des cellules doit être contrôlée au microscope optique ou électronique. La capacité des cellules fantômes préparées à induire une immunisation correcte doit être étudiée. La séquence du traitement est également une question importante. Par exemple, les microbes producteurs d'exopolysaccharides doivent d'abord être traités avec du NaOH. Après avoir préparé les MG, les cellules doivent être étudiées pour l'existence de colonies viables. De plus, les cellules viables doivent être désactivées, reconverties en fantômes ou l'ensemble des lots doit être stérilisé (en cas de microbes mortels). Il peut être intéressant de souligner que le vaccin et les technologies immunologiques sont une technologie de pointe et dans certains cas, des grammes de MG correctement préparés sont nécessaires pour satisfaire la demande.

Pourquoi NaOH et pourquoi SDS ? : NaOH et SDS sont deux composés bien connus utilisés pour l'isolement de plasmides à partir de bactéries gram-négatives. Le protocole est nommé "protocole de lyse alcaline pour l'isolement de plasmides". Le tampon de lyse fait de NaOH à dix pourcentages (pas d'autoclave) et de SDS (doit être autoclavé) comme solutions mères (400 l de SDS à dix pourcentages sur 3400 l d'eau puis ajouter 80 l de NaOH à dix pour cent). NaOH et SDS sont tous deux utilisés pour préparer le tampon de lyse en les mélangeant avec de l'eau. Le SDS introduit des pores dans les cellules bactériennes. Pour cela, il est ajouté à la plupart des dentifrices, utilisés en tampon de lyse pour l'isolement des plasmides et pour une partie du protocole d'isolement de l'ADN. Si l'on utilise du SDS dans son MIC qui pourrait donner un effet minimal et introduire des pores dans les cellules bactériennes, un tel concept était l'une des clés du succès pour isoler l'ADN de tout microbe gram-négatif sans avoir besoin d'acheter des kits coûteux. L'augmentation de la température et du temps d'exposition était une option supplémentaire en cas de bactéries gram-positives [35]. NaOH s'avère efficace sur la paroi cellulaire et pour cela, il vaut mieux utiliser son MGC. Cependant, c'est un puissant tueur de bactéries. Pour cela, il est recommandé de l'utiliser dans un premier temps pour désactiver les souches capables de muter et résister aux étapes de préparation des fantômes.

Pourquoi MIC et MGC ? : La CMI est un point critique où le produit chimique, le médicament, les enzymes ou les agents antimicrobiens utilisés sont capables de tuer le microbe dans les conditions d'investigation avec un effet secondaire minimal sur leurs cellules. Dans l'expérience de dilution en série, c'est le tube après la MIC, qui montre la première croissance et qui, étant donné le nom de MGC, une telle concentration devrait encore être efficace sur le microbe d'une manière ou d'une autre. En utilisant le concept selon lequel des composés chimiques et des enzymes ont été utilisés dans leur CMI en un temps ou une combinaison entre la CMI et le MGC d'autres composés, cela soutiendra le concept de génération d'effet minimum sur la paroi cellulaire des souches microbiennes. En d'autres termes, les combinaisons utilisées collaborent pour faire un travail détendu en se complétant les unes les autres.

Conception expérimentale-Plackett-Burman, Box-Behnken et le solveur Excel pour l'optimisation : La conception expérimentale a été utilisée pour optimiser de nombreux processus biologiques. Il a également été utilisé pour optimiser la production des BG. La conception expérimentale nécessite deux niveaux pour chaque variable, l'un est faible et l'autre est élevé. Et, il est préférable d'utiliser de quatre à dix variables. Dans le protocole original, douze expériences sont menées. Chaque expérience contient soit le niveau haut, soit le niveau bas de chacun des microbes utilisés. Toutes les expériences utilisées doivent être différentes et suivre la conception de Plackett-Burman. Par conséquent, concernant la concentration des composés chimiques utilisés, la CMI est la plus élevée +1 et la MGC est la plus faible -1 [36].

CaCO3 ou NaHCO3: CaCl2 est utilisé dans la préparation des cellules compétentes. CaCl2 est capable de faciliter le mouvement du plasmide de l'extérieur des cellules vers son intérieur. Il peut faire la même chose avec le SDS et d'autres composés.

L'utilisation d'un autre composé à base de "Ca" plus fort donnera de meilleurs résultats avec certains microbes. Certains pourraient avoir une double activité en tant que transfert membranaire et en tant qu'alcali tel que CaCO3 et NaHCO3. CaCO3 a été choisi parce qu'il a une autre propriété unique qu'il est peu dissous dans l'eau même après son autoclavage et qu'il peut être utilisé comme suspension.

NaHCO3 a été utilisé avec les premiers eucaryotes préparés comme des fantômes en utilisant l'idée de la concentration chimique critique [37,38].

Éthanol : L'éthanol peut être utilisé pour précipiter l'ADN et la protéine s'il est utilisé à 90 pour cent. S'il est utilisé à une concentration de 70 pour cent qui permet à la fois la précipitation et l'élimination des sels (la teneur en eau de 30 pour cent le permet). Cependant, s'il est utilisé à une concentration inférieure à 70 pour cent, il pourrait également éliminer le sel, l'ADN, l'ARN et la protéine soluble. Dans le protocole SL, 60% de l'éthanol a été utilisé pour évacuer le contenu des cellules bactériennes de leur ADN, ARN et les sels.

Lysozyme : Le lysozyme est une enzyme présente dans certains tissus et sécrétions et est considéré comme faisant partie du mécanisme de défense contre les agents pathogènes alors qu'il est capable de lyser certains microbes. Le mécanisme de son activité réside principalement dans son ciblage vers l'exopolysaccharide bactérien existant dans la paroi cellulaire provoquant un choc osmotique ou une lyse. La source la plus connue est l'œuf de poule, la salive, le lait et le bactériophage T4. Son substrat est constitué de résidus alternés d'acide β-N-acétylémuramique (MurNAc) lié (1-4) et d'β-N-acétylelucosamine (GlcNAc). Le lysozyme hydrolyse la liaison entre C-1 de l'acide β-N-acétylémuramique et C-4 de GlcNAc. La chitine ( G-1-4-linked GlcNAc) est également un substrat [31].

Protéinase K : L'une des endopeptidases capables de digérer la kératine et c'est une sérine protéinase à large spectre. Il est activé par le calcium. Il est utilisé pour éliminer l'acide nucléique contaminant les protéines. L'activité de l'enzyme est stimulée par des dénaturants tels que le SDS. Il est toujours utilisé côte à côte avec des lysozymes. La protéinase K peut être utilisée pour améliorer la préparation des MG [39].

Centrifugation : Que peut-il se passer si le pore de la paroi cellulaire microbienne est si petit et que les cellules bactériennes sont toujours capables de maintenir leur contenu (même le microbe a un si petit pore). Pour résoudre un tel problème, la centrifugation sera le meilleur procédé pour presser les cellules microbiennes.

Après l'introduction d'un seul pore (petit ou gros) ou plus d'un seul pore, les cellules microbiennes peuvent encore être en mesure de se maintenir. Leur contenu cytoplasmique dû à la membrane préplasmique, la centrifugation va pouvoir presser les cellules pour se débarrasser de leur contenu. On peut imaginer que les cellules descendent au fond de l'éprouvette en raison de la force de centrifugation. Après avoir été réglé et agrégé. Les cellules pressées comme l'éponge et les cellules continuent de se débarrasser de leur contenu. Par conséquent, le protocole a reçu le nom de protocole SL. Il faut donc utiliser une vitesse de centrifugation adaptée. Il ne faut pas dépasser la vitesse de 4000 rpm/min lors de la préparation des fantômes. Une vitesse de 2000 à 3500 rpm/min donnera une meilleure qualité de cellule.

La lessive: Le lavage est une étape importante car après la culture et pendant l'étape de centrifugation la surface microbienne et la biomasse piègent les débris et les acides gras. De telles cellules contaminant les éléments doivent être éliminées. Dans la plupart des cas, un tel constituant cytoplasmique ou le reste de la condition de croissance pourrait neutraliser l'effet des composés chimiques ou des enzymes utilisés. De plus, le lavage permet de se débarrasser du contenu cytoplasmique élaboré. Ainsi, plusieurs étapes de lavage à l'aide d'une solution saline pourraient améliorer la qualité des MG. En fait, après chaque étape de centrifugation, les échantillons de chaque surnageant doivent être examinés par spectrophotométrie ou en utilisant une électrophorèse sur gel pour surveiller l'élimination de l'ADN et de la protéine. Après le succès du protocole, ses étapes peuvent être réduites et optimisées.

La qualité BGs : L'étape ci-dessus concerne la surveillance de l'élimination du cytoplasme, ce qui n'indique pas que les parois cellulaires microbiennes sont sûres et ne se sont pas détériorées ou endommagées. Une question est immergée, comment évaluer la qualité des parois cellulaires des MGs lors des étapes de préparation des fantômes ? La qualité des MG préparés est un enjeu important. Le microscope optique doit donner un jugement correct. Cependant, le microscope électronique donnera une évaluation précise de la structure 3D bactérienne.Pour évaluer la qualité des BG, il faut compter au hasard dans une certaine zone dix bactéries et compter le nombre de cellules qui ont une structure 3D correcte et les utiliser en pourcentage. L'hémocytomètre peut être utilisé pour des résultats plus précis. Les deux microscopes électroniques à balayage et à transmission peuvent être utilisés pour évaluer la qualité des MG.

Le microscope électronique est absolument la preuve que les BG ou MG préparés sont des cellules excellentes, très bonnes, bonnes ou endommagées. En cas d'utilisation des microscopes électroniques, il suffit de répandre une goutte d'eau distillée sur la surface de la lame du microscope. Après cela, les MG dilués ont été ajoutés, étalés doucement et laissés sécher à l'air. Après avoir été bien séché, il faut relaver le frottis microbien pour éliminer tous les cristaux de sel (pour obtenir un meilleur résultat au microscope électronique) [40]. Le frottis microbien a ensuite séché à nouveau. En cas de microscope à transmission, le protocole standard est utilisé.

1. Préparez une souche microbienne pure et identifiée, simplement en appliquant la méthode des stries pour étaler les cellules dans le milieu approprié ou sur la plaque de milieu sélectif. Vous devez veiller à ce que le milieu utilisé ne mute pas votre souche.

2. Ramasser une seule colonie et la redistribuer à la surface d'un milieu approprié et remarquer son phénotype.

3. Testez les cellules bactériennes à l'aide d'un microscope optique pour être sûr de leur type et de leur pureté. La coloration simple et la coloration de Gram doivent être utilisées.

4. Prélever une seule colonie pure à l'aide d'une aiguille stérile ou d'un cure-dent et l'ensemencer dans un flacon de 25 ml contenant 10 ml du milieu de bouillon approprié. Et incuber pendant la nuit. Des cellules fraîches donneront un meilleur résultat MIC et MGC.

Détermination de la CMI et de la MGC pour NaOH, SDS et H2O2, enzymes, etc.

1. Préparez plusieurs tubes à essai contenant 5 ml ou 4,5 ml du milieu approprié afin de réaliser l'expérience de dilution en série.

2. Ajouter 0,5 ml des solutions ci-dessus chacune dans le premier tube à essai d'un ensemble de tubes (7 tubes) et transférer 0,5 ml d'un à un deuxième tube comme dans le protocole standard de la dilution en série. Retirer 20 ul de chaque tube et ajouter 20 ul d'environ 10 8 de la culture cellulaire d'une nuit dans chaque tube (pour chacune des expériences liées au composé chimique ci-dessus). Tout changement de dilution doit être pris en compte. Incuber les tubes à 37°C pendant la nuit (ou à la température de croissance recommandée pour le microbe étudié). Calculer la MIC et la MGC pour chacun des composés chimiques utilisés.

3. En cas de CaCO3 il a été utilisé soit à 1,05 g/mL, soit à 0,35 g/mL.

Après la collecte, les cellules vieillies par centrifugation et les lavages avec une solution saline plusieurs fois selon le type de microbe utilisé, on peut suivre l'une des stratégies ci-dessous.

Stratégie n°1 (Le protocole SL original avec douze protocoles d'expériences Plackett-Birman) (Figure 4).

La méthode utilisée à l'origine est basée sur l'utilisation d'une stratégie de concentration 5x. NaOH, SDS et CaCO3 ont été utilisés en une seule étape. Ensuite, les cellules lavées traitées avec H2O2 dans la deuxième étape. Après suffisamment d'étapes de lavage et de centrifugation, 60 pour cent d'éthanol est utilisé dans la troisième étape. Chacune des douze expériences utilisées suit la conception de Plackett-Burmen comme dans le protocole original [41].

Stratégie n°2 (Le protocole réduit de Plackett-Burman) (Figure 5) comme dans la stratégie no-1., exactement mais seules les deux meilleures expériences ont été sélectionnées. Ce protocole réduit a été conçu pour être utilisé uniquement pour les souches similaires telles que E. coli BL21 et JM109. Cependant, il a été utilisé pour d'autres microbes et s'est avéré efficace [42].

Stratégie n°3 (La stratégie 2x) (Figure 6), on peut utiliser une concentration 2x des composés chimiques utilisés chacun dans une étape séparée au lieu de 5 x. Par exemple ajouter un ml de cellules bactériennes en suspension à un ml de 2x de NaOH (NaOH 10 % est stérile par lui-même mais s'il est dilué il faut éviter toute contamination). Le stock 2x (préparé selon les résultats de la MIC et de la MGC comme recommandé, en protocole réduit Plackett-Burman) est préparé et ajouté aux bactéries. Cela dépend de l'expérience une ou deux dans le protocole réduit. Après avoir terminé le traitement, centrifugé les cellules et lavé, le traitement avec les 2x de chaque composé de MIC/MGC est démarré. Cela nous permet d'utiliser NaOH seul avec le microbe producteur d'exopolysaccharide pour le tuer et de prendre aux cellules la chance de produire l'exopolysaccharide.

Stratégie n°4, (Le protocole spécial pour les souches mutées telles que la souche productrice d'exopolysaccharides (par exemple P. aeruginosa). Après avoir travaillé avec un expolysaccharide produisant des souches, ou des souches eucaryotes et des virus. Il devient clair que H2O2 pourrait induire une résistance. Dans un tel cas, NaOH doit être utilisé dans le premier traitement pour tuer les cellules microbiennes et l'empêcher de produire l'exopolysaccharide. Et dans le même cas, la CMI doit être testée correctement alors que l'exopolysaccharide donnera un résultat erroné. En cas d'obtention d'un MIC erroné, on peut utiliser le MIC qui est calculé le E. coli ou utiliser une concentration moindre tandis que l'exopolysaccharide donnera une valeur MIC élevée [43].

Stratégie n°5 Utilisation d'enzymes après détermination de leur CMI et MGC côte à côte avec les composés chimiques utilisés en particulier avec certaines souches gram-positives et halophiles [en cours d'optimisation].

Le protocole SL est un protocole simple, peu coûteux et interne. Cependant, l'un des objectifs de cette revue est de donner au lecteur la tactique, les problèmes, les solutions et l'image les plus testés au cours de sa conception d'expérience. Cette revue doit être lue en étapes détaillées pour permettre au lecteur de mettre en œuvre ou de concevoir son propre protocole pour une souche microbienne particulière. Le protocole peut être utilisé pour préparer des fantômes à partir de presque toutes les souches bactériennes, levures et virus. On peut utiliser n'importe laquelle des stratégies expliquées dans ce protocole et incluses dans cette revue. Il est important de déterminer la CMI des composés chimiques et des enzymes utilisés pour démarrer le protocole. Il faut également connaître certaines informations importantes sur les microbes utilisés, qu'ils soient gram-négatifs ou positifs, le producteur d'exopolysaccharides, la capacité des souches à être mutagénisées, etc.

Les conseils suivants donneront au lecteur une image lors de la conception de son expérience. Cette critique doit être lue attentivement pour avoir toute l'idée à l'intérieur.

1. Vous devez effectuer toutes vos expériences dans des conditions aseptiques et une expérience microbiologique bien planifiée dans un laboratoire microbiologique contenant toutes les installations nécessaires. Par exemple, toute contamination par un microbe sporulé tel que Bacille sp donnera de mauvais MIC et MGC.

2. Pour les microbes pathogènes mortels, des précautions particulières doivent être prises. Il faut se référer aux conseils techniques concernant la manipulation du ou des microbes étudiés.

3. Vous devez connaître les informations appropriées sur la souche microbienne, dont vous allez évacuer son cytoplasme (gram positif ou négatif, sporogène, producteur d'exopolysaccharides, levure, champignons, trophozoïte, etc.).

4. Vous devez utiliser une souche pure. Mieux vaut revérifier la pureté de la souche.

5. Vous devez connaître sa morphologie sur plats et au microscope optique.

6. Certains microbes sont sensibles aux composés chimiques utilisés dans le protocole tels que P. aeruginosa, qui est sensible au H2O2 et peut être transformé en mucoïde (producteur d'exopolysaccharides). Pour cela, il est recommandé d'utiliser du NaOH dans un premier temps.

7. Vous pouvez modifier le protocole en utilisant chaque composé en étapes distinctes (stratégie 2x). Pour cela, vous pouvez simplement préparer 2x stock à la fois du MIC et du MGC que vous allez utiliser.

8. Dans certains cas particuliers où MIC et MGC n'ont pas pu être calculés correctement, on peut utiliser soit le E. coli MIC et MGC ou celle d'autres souches apparentées.

9. Dans l'étape de dilution en série, vous devez utiliser un tube en verre pour obtenir un résultat MIC et MGC correct. Les tubes en plastique peuvent donner un mauvais jugement.

10. Vous devez éviter l'agrégation ou le clampage, donc un volume approprié doit être utilisé pour permettre un contact correct entre les cellules microbiennes et les composés chimiques utilisés.

11. Préparez une concentration double (ou plus) du MIC et du MGC. Par conséquent, vous pouvez atteindre la concentration correcte après avoir ajouté la solution qui contient le microbe à l'étude. Dans ce cas, il est recommandé d'utiliser la stratégie 5x comme dans le protocole d'origine. Cependant, pour le débutant, il est recommandé d'appliquer NaOH, SDS, H2O2 et CaCO3 en utilisant le protocole 2x séparément.

12. Mieux vaut vieillir le microbe pour obtenir une paroi cellulaire plus solide et dans certains cas pour réduire les facteurs de virulence du microbe. Alternativement, certains composés chimiques peuvent induire une rigidité cellulaire.

13. Il faut surveiller la libération de l'ADN et de la protéine, par spectrophotométrie et en utilisant l'électrophorèse sur gel.

14. Utiliser une centrifugation douce ne dépassant pas 3 500 tr/min.

15. Laver plusieurs fois après chaque étape pour éliminer les résidus de composés chimiques en utilisant une solution saline (0,5 à 0,9 pourcentage) ainsi que pour éliminer plus d'ADN et de protéines (etc.).

16. Recherchez la souche productrice d'exopolysaccharides et démarrez le protocole avec NaOH pour les tuer en premier.

17. Vous pouvez conserver le tube à essai de la dilution en série pendant plus d'une journée et vous pouvez réévaluer la concentration que vous utilisez. Cela parce que certains microbes se développent lentement.

18. Calculez correctement la concentration. Tout mauvais calcul peut endommager les cellules. Le microscope optique est un outil approprié pour surveiller la qualité des cellules lors de l'ajustement de la CMI et de l'effet MGC.

19. Vous pouvez également modifier le temps d'exposition du microbe aux composés chimiques ou enzymes utilisés. Cependant, un contrôle régulier de la qualité des cellules à l'aide d'un microscope optique doit être suivi pour éviter la lyse cellulaire.

20. Vous pouvez prolonger l'exposition microbienne au H2O2 pendant la nuit.

21. N'oubliez pas que NaOH dans le protocole original a été utilisé dans les deux expériences (1 et 2) comme -1, ce qui signifie le MGC. Pour un certain microbe, vous pouvez augmenter la concentration du NaOH jusqu'à la CMI mais sous le contrôle du microscope optique.

22. Après avoir terminé les étapes de préparation des MG, vous devez examiner la viabilité de la cellule. En cas d'existence de cellules viables dans l'une ou les deux expériences menées, vous devez répéter les étapes de préparation des fantômes, mais vous pourrez toujours utiliser à nouveau vos MG préparées incomplètes. Il n'est pas nécessaire de préparer de nouvelles cellules si les cellules sont de bonne qualité (étudier la qualité des cellules à l'aide du microscope optique).

23. Dans les microbes complexes, la conception expérimentale doit être utilisée. Plackett-Burman, Box Behnken et le solveur Excel peuvent être utilisés en séquence pour obtenir l'optimisation la plus attendue. En fait, la conception expérimentale pourrait cartographier les points critiques impliqués dans la préparation des fantômes cellulaires et pourrait être en mesure d'optimiser parfaitement tout processus compliqué. Pour cela, la CMI des composés utilisés dans le protocole SL pourrait être utilisée dans la différenciation des souches. Des souches similaires comme dans le cas de E. coli Bl21 et JM109 prouvent qu'ils ont des MIC et MGC différents.
Optimisation de l'écart entre MIC et MGC qui peut être réalisé en utilisant Plackett-Burman, Box-Behnken et le solveur Excel.

24. Le spectrophotomètre et l'électrophorèse peuvent être utilisés pour surveiller l'évacuation du contenu cytoplasmique.

25. Les meilleures MG sont celles qui sont mortes, vides de leur contenu cytoplasmique, ont une structure 3D correcte et sont capables d'induire le système immunitaire lors de leur traitement.

26. L'électrophorèse sur gel de polyacrylamide peut être utilisée pour montrer les différences entre les cellules viables et les fantômes. Dans le protocole original, les cellules viables, qui existaient après l'exécution de ce protocole (ne se sont pas transformées en fantômes morts et toujours viables), ont été soumises à une lyse en induisant le gène du lysozyme porté sur le plasmide pLysS.

Après l'introduction de la concentration chimique critique et de la méthode d'activité pour préparer les MG, de nombreux faits ont été modifiés et un large éventail de cellules microbiennes et mammifères ainsi que d'autres conteneurs biologiques ont pu être évacués à l'aide d'un tel protocole. Par conséquent, une nouvelle définition des MG peut être introduite comme suit :

"Les MG sont des cellules microbiennes vides et mortes ou des virus (enveloppes) dépourvus de contenu cytoplasmique ou de tout élément fluidisé interne ou de tout élément génétique. Cela a été causé par un ou plusieurs pores dans leurs parois cellulaires. Ou l'élimination directe des éléments génétiques. Ils ont une structure 3D correcte, une morphologie et une structure d'antigènes de surface natifs capables d'inciter le système immunitaire de l'hôte livré à produire des anticorps spécifiques qui pourraient réagir correctement avec la cellule mère viable ou les virus.De plus, en tant que cellules vides, ils peuvent être utilisés comme administration de médicament système pour divers médicaments, gènes et antigène ou protéine exprimée en antigène de surface à partir d'une autre bactérie pathogène puissante. Les méthodes de concentration chimique critique et d'activité enzymatique ont étendu le spectre des BG


Guide de dépannage pour le clonage

Nous vous recommandons fortement d'exécuter les contrôles suivants lors des transformations. Ces contrôles peuvent aider à dépanner quelle(s) étape(s) du workflow de clonage a échoué.

  1. Transformez 100 pg&ndash1ng de vecteur non coupé pour vérifier la viabilité cellulaire, calculer l'efficacité de la transformation et vérifier la résistance aux antibiotiques du plasmide.
  2. Transformez le vecteur coupé pour déterminer la quantité de fond due au plasmide non digéré. Le nombre de colonies dans ce contrôle doit être <1 % du nombre de colonies dans la transformation de contrôle plasmidique non coupé (à partir du contrôle n° 1).
  3. Transformer une réaction de ligature vectorielle uniquement. Les extrémités du vecteur ne devraient pas pouvoir se religaturer car soit elles sont incompatibles (par exemple, digérées avec deux enzymes de restriction qui ne génèrent pas d'extrémités compatibles) soit le groupe phosphate 5´ a été éliminé dans une réaction de déphosphorylation (par exemple, extrémités franches traité avec rSAP). Cette transformation de contrôle devrait donner le même nombre de colonies que le contrôle #2.
  4. Digérer l'ADN vecteur avec une seule enzyme de restriction, religuer et transformer. Les extrémités de l'ADN vecteur doivent être compatibles et facilement jointes pendant la réaction de ligature, ce qui donne approximativement le même nombre de colonies que le contrôle #1.

Le flux de travail de clonage bénéficie souvent d'une quantification précise de la quantité d'ADN avec laquelle on travaille. Nous recommandons la quantification des ADN dans la mesure du possible.


Résumé

Depuis la découverte de la proprotéine convertase subtilisine kexine 9 (PCSK9) en 2003, ce PC a beaucoup attiré l'attention de la communauté scientifique et des sociétés pharmaceutiques. Sécrétée dans le plasma par le foie, la sérine protéase de type protéase K PCSK9 se lie au récepteur des lipoprotéines de basse densité (LDL) à la surface des hépatocytes, empêchant ainsi son recyclage et augmentant sa dégradation dans les endosomes/lysosomes, entraînant une réduction du LDL- clairance du cholestérol. Étonnamment, de manière non enzymatique, PCSK9 améliore la dégradation intracellulaire de toutes ses protéines cibles. Les variantes rares de gain de fonction de PCSK9 entraînent des taux plus élevés de cholestérol LDL et un risque accru de maladie cardiovasculaire. Il a fallu 9 ans pour élaborer de nouvelles approches thérapeutiques puissantes basées sur PCSK9 pour réduire les niveaux circulants de cholestérol LDL. Actuellement, les anticorps monoclonaux PCSK9 qui inhibent sa fonction sur le récepteur LDL sont évalués dans des essais cliniques de phase III. Cette revue portera sur les aspects biochimiques, génétiques et cliniques associés à la biologie et à la physiopathologie de PCSK9 dans les cellules, les rongeurs et les humains, en mettant l'accent sur les avantages cliniques de faire taire l'expression/l'activité de PCSK9 en tant que nouvelle modalité dans le traitement de l'hypercholestérolémie et des pathologiques.

Au cours des années 1960 aux années 1970, 1,2 il a été fermement établi que de nombreuses protéines sécrétoires bioactives, y compris les hormones polypeptidiques et les enzymes, sont initialement produites en tant que précurseurs inactifs qui sont transformés en fragments bioactifs par protéolyse limitée, comme illustré par la transformation de la pro-opiomélanocortine en l'hormone adrénocorticotrope et la β-endorphine 3 et la proinsuline en insuline. 4 Cette théorie a conduit au concept 5 selon lequel la conversion d'un précurseur sécrétoire inactif en produit(s) actif(s) est catalysée par un groupe spécial de protéases appelé les proprotéines convertases (PC). Ces protéases clivent des précurseurs à la fois dans les voies sécrétoires constitutives et régulées pour produire une protéine/un peptide mature ou de multiples fragments bioactifs. De 1990 à 1999, 8 PC de mammifères ont été découverts et se sont révélés responsables du traitement spécifique aux tissus de divers précurseurs sécrétoires. 6,7 Les substrats de ces PC comprennent des hormones, des facteurs de croissance, des récepteurs, des métalloprotéases, des facteurs de transcription liés à la membrane et des glycoprotéines de surface. Ainsi, en fonction de leur site d'action et de leurs activités protéasiques, 8 PC sont impliqués de manière vitale dans différents processus physiologiques et cliniquement pertinents, 9,10 entraînant des événements d'activation/inactivation, dont certains affectent la santé cardiovasculaire. 11

Un criblage exhaustif basé sur la réaction en chaîne de la polymérase pour un nouveau PC de mammifère a conduit à la découverte du neuvième et dernier membre de la famille, connu sous le nom de PC subtilisine kexine 9 (PCSK9), qui a été signalé au début de 2003. 12 Chez les rongeurs, PCSK9 a été s'est avéré être exprimé principalement dans les hépatocytes du foie adulte, beaucoup moins dans l'intestin grêle et les reins, et exprimé de manière transitoire dans le système nerveux central en développement. 12 En raison de sa riche expression dans les hépatocytes du foie et de la localisation de son gène (PCSK9) sur le chromosome humain 1p32, une région liée à l'hypercholestérolémie familiale (FH) dans certaines familles françaises, 13 il a été suspecté et bientôt confirmé de représenter le troisième locus FH, avec le récepteur des lipoprotéines de basse densité (LDLR) et l'apolipoprotéine B (ApoB) gènes étant les autres 2. 14 Des revues récentes ont documenté de manière exhaustive l'histoire de la découverte de PCSK9 et sa relation avec les maladies cardiovasculaires (MCV). 6,7,15,16

Après la découverte de PCSK9 et sa relation avec les taux circulants de LDL-cholestérol (LDL-C), 12,14 une course a été déclenchée dans le monde entier pour trouver non seulement de nouvelles mutations de gain de fonction (GOF) provoquant une hypercholestérolémie 14,17 mais aussi des mutations de perte de fonction (LOF) compatibles avec une hypocholestérolémie. 18,19 La variante anglo-saxonne D374Y PCSK9 très active est la mutation GOF la plus remarquable, 20 tandis que la mutation LOF non-sens africaine hétérozygote C679X est en corrélation avec une réduction remarquable de 88 % du risque de MCV par rapport aux non-porteurs. 21 De tels effets d'abaissement du LDL-C sont également observés chez les sujets canadiens-français avec une mutation Q152H négative dominante, qui empêche le clivage autocatalytique de proPCSK9 en PCSK9 dans le réticulum endoplasmique (RE). 12,22 De plus, 2 mutations complètes du LOF provoquant une hypocholestérolémie marquée se sont révélées compatibles avec la vie et ont entraîné un niveau étonnamment bas de taux de LDL-C circulant 0,4 mmol/L. 23,24 En effet, les mammifères peuvent survivre et rester en bonne santé sans PCSK9, comme cela a également été confirmé dans Pcsk9-souris knock-out.25,26 Cependant, cela ne semble pas être le cas chez certains vertébrés inférieurs, où la suppression de l'ARNm de PCSK9 chez le poisson zèbre entraîne une désorganisation du système nerveux et une létalité. 27

Un tiers de la population adulte aux États-Unis avait un LDL-C élevé et, par conséquent, est à risque de MCV. De plus, un traitement hypocholestérolémiant basé uniquement sur les statines s'est avéré futile chez un nombre important de patients qui sont soit résistants aux statines et ne répondent pas de manière adéquate, soit présentent des effets secondaires graves à ces médicaments. 28 Les inhibiteurs de PCSK9 sont récemment apparus comme une nouvelle classe alternative de médicaments hypocholestérolémiants. A ce jour, la propriété la mieux étudiée de PCSK9 est de se lier au LDLR dérivé des hépatocytes conduisant à sa dégradation intracellulaire. La perturbation de cette interaction protéine-protéine [PCSK9≡LDLR] empêche la dégradation du LDLR, augmentant ainsi les niveaux de LDLR, abaisse le LDL-C, 29,30 et est censé protéger du développement de l'athérosclérose. 31

Biologie structurale et cellulaire de PCSK9

PCSK9 Ontogénie, biosynthèse, structure et dégradation du LDLR

Le gène humain de 22 kb PCSK9 est situé sur le petit bras du chromosome 1p32 et contient 12 exons et 11 introns. 11 Le gène code pour une sérine protéase de type K de 692 acides aminés (aa) appelée PCSK9 14 (appelée à l'origine convertase régulée par l'apoptose neurale). 6 Au cours du développement des rongeurs, PCSK9 s'est révélé être exprimé de manière transitoire dans les centres du cerveau, tels que le télencéphale, le bulbe olfactif et le cervelet. 6 Une hybridation in situ récente a montré que l'ARNm de PCSK9 est également abondant dans la paroi de l'artère ombilicale embryonnaire, y compris les cellules musculaires lisses présumées et dans les membranes embryonnaires (N.G. Seidah, et al, données non publiées, 2014). Chez l'adulte, PCSK9 reste fortement exprimée dans les hépatocytes du foie et moins dans l'intestin grêle et les reins. 6

PCSK9 présente une voie d'activation du zymogène atypique par rapport aux 8 autres membres de la famille des PC, 12,32 et son activité et sa biologie associées en font une valeur aberrante par rapport aux PC classiques. La protéinase K-like PCSK9 12 partage une similarité de séquence avec de nombreuses espèces de vertébrés, y compris le chimpanzé, le singe rhésus, la souris, le rat, le poisson zèbre de poulet et environ 40 autres espèces (http://www.ncbi.nlm.nih.gov/). Cependant, bien que le PCSK9 gène n'est pas trouvé dans la plupart des invertébrés, il se trouve dans certains, tels que Branshiostoma floridae, un céphalocordé. 33 Chez les vertébrés, certaines espèces, comme le bovin, n'expriment pas la protéine. L'analyse du génome bovin a révélé la présence d'un PCSK9 gène avec l'absence d'exons d'extrémité 3' et une terminaison précoce à l'exon 10, 33 suggérant une sélection par délétion chez certaines espèces végétariennes. En pratique, cela signifierait que le sérum bovin fœtal universellement utilisé dans les milieux de culture cellulaire n'aurait pas de PCSK9 endogène.

Après clivage de son peptide signal (aa 1-30) dans le RE, le zymogène proPCSK9 (aa 31-692) ne peut sortir de ce compartiment jusqu'à ce qu'il se clive par voie intramoléculaire à la séquence Val-Phe-Ala-Gln152↓Ser-Ile-Pro (VFAQ152↓SIP) pour libérer l'enzyme mature (aa 153–692). Fait intéressant, proPCSK9 a tendance à oligomériser dans le RE d'une manière dépendante du disulfure. 12,34 Analyse de la spécificité de PCSK9 pour le clivage autocatalytique au P1 Gln152 ont démontré que les seuls résidus P1 qui peuvent être reconnus par PCSK9 sont Gln>Met>Ala>Ser>Thr≈Asn, révélant une spécificité de clivage insoupçonnée. 34 Cependant, à la différence des autres CP, la PCSK9 mature reste liée de manière non covalente à son prosegment inhibiteur (aa 32-152) et est sécrétée sous la forme d'un complexe [prosegment≡PCSK9] (Figure 1). 12,35 Ce dernier est enzymatiquement inactif car le prosegment occupe la fente du site actif de la protéase et l'empêche d'interagir avec d'autres substrats (Figure 1). 36 Ainsi, PCSK9 n'a pas d'autre substrat qu'elle-même, et son activité est liée à sa liaison à des protéines cibles spécifiques et à l'escorte du complexe résultant vers les compartiments de dégradation intracellulaire. La sous-unité catalytique de PCSK9 (aa 153–421) contient les sites actifs Asp186, Le sien226, et Ser386 et le trou oxyanion Asn317, qui sont typiques de toutes les protéases à sérine de type subtilisine. 6 Une petite région charnière 18-aa (H aa 422-439) relie la sous-unité catalytique au domaine riche en cys-his-C-terminal (CHRD aa 440-692 Figure 1). La première structure cristalline de PCSK9 a révélé que le CHRD est composé de 3 modules appelés M1 (aa 453–531), M2 (aa 530–605) et M3 (aa 604–692), et la plupart des résidus His dans le CHRD (9 sur un total de 14 His) se trouvent dans le domaine M2 alignant une structure en forme de sillon. 36,37

Figure 1. Représentation schématique de la transformation du zymogène de la proprotéine convertase subtilisine kexine 9 (PCSK9) et de sa liaison au récepteur des lipoprotéines de basse densité (LDLR). UNE, Le traitement autocatalytique du zymogène de proPCSK9 (75 kDa) à Val-Phe-Ala-Gln152↓Ser-Ile-Pro (VFAQ152↓SIP) dans le complexe [prosegment (15 kDa)≡PCSK9 (62 kDa)] est souligné, ainsi que les positions du site actif Asp186, Le sien226, et Ser386 et le trou oxyanion Asn317. Le domaine charnière C-terminal (H) et le domaine riche en cys-his (CHRD) sont montrés. B, Représentation de bande dessinée de l'interaction de la surface cellulaire du domaine catalytique de PCSK9 avec le facteur de croissance épidermique-A (domaine du LDLR, ainsi que l'interaction suspectée du prosegment avec le domaine -baril du LDLR et du CHRD avec un la protéine putative liée à la membrane X. C, Structure cristalline de l'ectodomaine du LDLR avec PCSK9 mettant l'accent sur l'interaction entre eux et les 3 sous-domaines du CHRD (M1, M2 et M3). L'interaction de la protéine X est présumée être avec l'un de ces derniers sous-domaines, éventuellement M2.

L'activité la mieux caractérisée du complexe [prosegment≡PCSK9] est sa capacité à se lier à des protéines cibles spécifiques et à les escorter vers des compartiments de dégradation intracellulaire. La première cible PCSK9 identifiée est le LDLR à la surface des hépatocytes du foie. 35,38,39 La sous-unité catalytique de PCSK9 s'est avérée se lier au domaine du facteur de croissance épidermique-A (EGF-A) du LDLR (Figure 2), 40,41 ainsi qu'au domaine similaire trouvé dans d'autres membres de la superfamille LDLR ( par exemple, très LDLR [VLDLR], récepteur de l'apolipoprotéine E 2 [ApoER2], 42,43 et protéine liée au récepteur des lipoprotéines 1 [LRP1] 44). Normalement, le complexe [LDLR≡ LDL-C] pénètre dans les cellules via les vésicules recouvertes de chaîne lourde de clathrine, et lorsqu'il est internalisé, le pH acide des endosomes provoque la dissociation allostérique du LDLR et son recyclage à la surface cellulaire, tandis que le LDL-C est dirigé vers les lysosomes pour la dégradation, où le cholestérol est récupéré et distribué dans la cellule (Figure 2). 45 En revanche, le complexe [PCSK9≡LDLR], bien qu'il pénètre également dans les cellules via des vésicules recouvertes de clathrine, 46,47 ne se dissocie pas à des pH acides mais est plutôt plus étroitement associé, 36 et, par un mécanisme inconnu, il est escorté jusqu'à lysosomes pour la dégradation par des protéases encore non définies. 35,46 Une complication supplémentaire est l'observation que PCSK9 peut améliorer la dégradation du LDLR soit par une voie intracellulaire directe ne nécessitant pas sa sécrétion 48 ou extracellulaire lors de la liaison du LDLR à la surface cellulaire (Figure 2). 49 Les chaînes légères de la clathrine ne sont pas nécessaires pour l'endocytose médiée par la clathrine mais sont essentielles pour le trafic médié par la clathrine entre les trans Réseau de Golgi et système endosomal. 50 En effet, les siARN de la chaîne légère de la clathrine qui bloquent le trafic intracellulaire direct de la trans Le réseau de Golgi aux lysosomes a rapidement augmenté les niveaux de LDLR dans les cellules HepG2 de la lignée cellulaire de carcinome hépatocellulaire humain d'une manière dépendante de PCSK9, sans affecter la capacité de PCSK9 exogène à améliorer la dégradation de LDLR. 48 Que ces 2 voies soient opérationnelles dans tous les tissus n'est toujours pas clair. À l'appui de ce modèle, une observation récente a révélé que PCSK9 dépourvu du domaine M2 du CHRD peut encore dégrader le LDLR de manière intracellulaire mais pas lorsqu'il est ajouté à l'extérieur des cellules, soutenant la présence de 2 voies de tri et de régulation distinctes du complexe [PCSK9≡LDLR] . 51

Figure 2. Représentation schématique des voies intracellulaires et extracellulaires de la proprotéine convertase subtilisine kexine 9 (PCSK9) induite par la dégradation du récepteur des lipoprotéines de basse densité (LDLR). Lorsque les niveaux de PCSK9 sont élevés ou s'il a un gain de fonction, cela augmentera la dégradation du LDLR en utilisant à la fois les voies intracellulaires et extracellulaires conduisant à la dégradation du complexe (PCSK9≡LDLR) dans les lysosomes. Cela se traduit par de faibles niveaux de LDLR à la surface cellulaire et des niveaux accrus de LDL-C circulant. En l'absence ou sous de faibles niveaux de PCSK9, les niveaux de LDLR à la surface cellulaire sont élevés et le LDLR peut être recyclé à la surface après la livraison de particules de LDL aux endosomes acides. La preuve de la voie intracellulaire est basée sur la suppression des chaînes légères de la clathrine dans les cellules HepG2 du carcinome hépatocellulaire humain. 48,50 Les traitements spécifiques à la voie extracellulaire comprennent l'utilisation d'un anticorps monoclonal (mAb), d'un adnectine inhibiteur ou d'un inhibiteur de type facteur de croissance épidermique A (EGF-A) à petite molécule. TGN indique le réseau Trans Golgi.

Il est intéressant de noter que les activités de dégradation intracellulaire et extracellulaire du LDLR de PCSK9 nécessitent la présence du CHRD car le complexe [PCSK9-ΔCHRD≡LDLR] qui manque de ce domaine, bien que toujours capable d'internalisation dans les endosomes, ne transite pas vers les lysosomes et est probablement recyclé à la surface de la cellule. 51,52 Cela a conduit à la recherche d'autres protéines qui peuvent interagir avec le CHRD et le LDLR et conduire le complexe [PCSK9≡LDLR] aux lysosomes.

Des rapports récents ont mis en lumière ce mécanisme encore obscur. Deux études suggèrent que le CHRD se lie faiblement à ≥1 des 7 répétitions de coordination Ca 2+ dans le domaine de liaison au ligand N-terminal du LDLR 53 et qu'une telle liaison peut être nécessaire pour empêcher la dissociation du [PCSK9≡LDLR] complexe dans les endosomes acides. 54 En outre, il a été suggéré que la liaison du CHRD chargé positivement au domaine de liaison au ligand du LDLR chargé négativement est favorisée à des pH acides, 53,54 où les résidus His du CHRD seraient chargés positivement. Ces données appuient la découverte qu'en dehors du domaine EGF-A, 3 des 7 répétitions de liaison au ligand du LDLR et du domaine -hélice sont nécessaires pour que le LDLR soit dégradé en présence de PCSK9. 52 Cependant, une telle liaison est susceptible d'être faible car toutes les structures cristallines rapportées de PCSK9 à pH neutre ou acide ne révèlent aucune interaction du CHRD avec les répétitions N-terminales (aa 25–313) du LDLR. Une exception est la faible interaction hydrophobe prédite de Leu626 du domaine -hélice du LDLR avec Leu108 du prosegment de PCSK9, 41 qui a également été déduit d'un mutant GOF L108R PCSK9 qui renforce éventuellement cette interaction en favorisant la liaison électrostatique de Glu605 du LDLR au mutant Arg108 de PCSK9. 17

Néanmoins, parce que la queue cytosolique du LDLR n'est pas nécessaire pour le tri du complexe [PCSK9≡LDLR] aux lysosomes, 44,55 cela suggère qu'une autre protéine doit se lier au domaine CHRD luminal et qu'une telle protéine X aurait également un effet transmembranaire. domaine et queue cytosolique liant les protéines motrices dans le cytosol pour diriger le complexe vers les lysosomes (Figure 1). 44 Dans ce contexte, un rapport récent a proposé que la protéine de type précurseur amyloïde-2 (APLP-2) puisse lier le CHRD à la surface des cellules et dans les endosomes, et que ce complexe tripartite [LDLR≡PCSK9≡APLP-2] est ensuite ciblée sur les lysosomes (Figure 2), 56 par un mécanisme encore indéfini. 57 L'APLP-2 et d'autres membres de la famille, tels que la protéine précurseur amyloïde et l'APLP-1, représentent-ils le ou les chaînons manquants pour comprendre le trafic cellulaire du complexe [PCSK9≡LDLR] vers les lysosomes ? Il est encore trop tôt pour trancher ce point car les analyses in vivo de App2-les souris knock-out font toujours défaut, et nos données préliminaires suggèrent que la suppression de l'expression d'APLP-2 dans les cellules n'affecte pas la capacité de PCSK9 à dégrader le LDLR ou le LRP1 44 à la fois intracellulaire et extracellulaire (M. Canuel, et al, données non publiées, 2014).

Quel est le rôle du prosegment dans le tri ou l'activité du complexe [prosegment≡PCSK9] ? Premièrement, la variante négative à dominance Q152H humaine a confirmé que le clivage autocatalytique de proPCSK9 en PCSK9 est une condition absolue pour la sortie de cette protéine de l'ER 12 et son amélioration ultérieure de la dégradation du LDLR. 22,34 Deuxièmement, parce que le [Δ31-58-prosegment≡PCSK9] dépourvu de la séquence acide N-terminale du prosegment (aa 31-58) est ≥4- à 7 fois plus actif dans la dégradation du LDLR, 58,59 cela suggère que cette région acide, qui est probablement non stabilisé par lui-même car il n'est visible dans aucune structure cristalline rapportée, est un régulateur négatif de l'activité de PCSK9 sur le LDLR. Des preuves récentes suggèrent que l'association de PCSK9 avec des particules de LDL dans le plasma réduit la capacité de PCSK9 à se lier au LDLR de surface cellulaire, atténuant ainsi la dégradation du LDLR induite par PCSK9. 60 Étant donné que l'ApoB est la principale protéine du LDL, cela suggère que c'est le composant actif qui lie PCSK9 dans le plasma et atténue sa fonction sur le LDLR. Il reste à démontrer si une telle liaison implique l'interaction des aa acides 31 à 58 à l'extrémité N du prosegment de PCSK9 avec un domaine chargé positivement dans ApoB. La cocristallisation de PCSK9 avec le domaine de liaison à l'ApoB devrait faire la lumière sur ce modèle.

La voie de sécrétion des cellules eucaryotes emballe les protéines cargo dans des vésicules recouvertes de Coat Protein-II pour le transport du RE vers l'appareil de Golgi, qui sont ensuite triées dans d'autres organites ou sécrétées. Quels sont les autres partenaires cellulaires de PCSK9 qui régulent sa sortie des urgences et son trafic ? Il a été récemment rapporté que la sortie du complexe [prosegment≡PCSK9] du RE nécessite une interaction avec une protéine membranaire putative qui lie via sa queue la protéine cytosolique sec24a associée aux vésicules COP-II. 61 L'absence de ce dernier entraîne des niveaux nettement inférieurs de PCSK9 sécrétée, conduisant à des niveaux plus élevés de protéines hépatiques LDLR en raison d'une dégradation réduite. Il serait stimulant de découvrir si l'inverse existe également (c'est-à-dire que certaines mutations dans PCSK9 ou son partenaire ER putatif peuvent augmenter la sécrétion de PCSK9 à partir du RE).

En conclusion, l'escorte et la dégradation du complexe [PCSK9≡LDLR] sont régulées par une variété de protéines, y compris PCSK9 et LDLR eux-mêmes, la protéine X, ApoB, sec24a, et très probablement, d'autres partenaires indéfinis et transitoires qui interagiraient avec ce complexe le long de la voie sécrétoire, même dès les urgences. 46,62 De plus, le PC Furin clive PCSK9 à Arg218à la surface des hépatocytes et entraîne probablement son inactivation in vivo, 63,64 suggérant que certaines protéases pourraient réguler l'activité de PCSK9. PCSK9 semble être unique par rapport aux autres PC dans le sens où c'est la seule convertase qui n'a qu'un seul substrat enzymatique, elle-même. Il semble que cette convertase relativement plus récente et polymorphe ait été sélectionnée pour son interaction protéine-protéine avec des récepteurs de type LDLR, plutôt que comme protéase, car le prosegment inhibiteur reste étroitement lié à la sous-unité catalytique. On ne sait pas encore s'il existe des facteurs, autres que le prosegment, qui pourraient également inhiber l'activité enzymatique de PCSK9. La conservation évolutive de cette enzyme suggère qu'un tel mécanisme de régulation a été maintenu chez la plupart des vertébrés mais pas chez les invertébrés qui expriment d'autres protéases de type PC.

Autres protéines cibles PCSK9

Bien que le LDLR soit sans aucun doute la cible la mieux étudiée de PCSK9 et probablement pertinente sur le plan physiologique, car il contrôle les niveaux de LDL-C circulant, il a également été découvert que PCSK9 escortait d'autres membres récepteurs de la superfamille LDLR vers la dégradation endosomale/lysosomale. Ainsi, PCSK9 s'est avéré pour la première fois améliorer la dégradation extracellulaire et intracellulaire des membres les plus proches de la famille LDLR, à savoir le VLDLR et l'ApoER2 (LRP8). 42,43 Cependant, bien que l'interaction du domaine catalytique de PCSK9 avec les domaines de type EGF-A de ces récepteurs ait été confirmée, les aa spécifiques de chaque protéine impliquée dans de telles interactions ne sont pas les mêmes que pour le LDLR. Par exemple, contrairement au LDLR, le GOF D374Y PCSK9 ne dégrade pas ces autres récepteurs plus efficacement que le PCSK9 de type sauvage. 42 Les récepteurs LDLR, VLDLR et ApoER2 ont été confirmés comme protéines cibles PCSK9 chez la souris 25,26,65,66 et le LDLR chez le singe 67 et l'homme. 68 Récemment, nous avons montré que PCSK9 peut améliorer la dégradation de LRP1 dans diverses cellules 44 bien que la preuve de cette activité in vivo fasse encore défaut. Enfin, CD36, un récepteur charognard doté de multiples ligands et fonctions cellulaires, notamment facilitant l'absorption cellulaire des acides gras libres (FFA), a également été suspecté d'être une cible PCSK9 dans les cellules épithéliales intestinales 69 et le tissu adipeux. 65 Récemment, cette activité de PCSK9 sur CD36 a été élégamment prouvée dans les cellules et les adipocytes. 70 parce que les structures de CD36 ou CD81 (voir ci-dessous) ne présentent pas de domaine de type EGF-A, leurs séquences respectives qui se lient directement ou indirectement à PCSK9 doivent encore être définies.

Le fait que de nombreux PC puissent traiter les glycoprotéines de surface des virus infectieux 6 nous a incité à tester l'effet du manque de PCSK9 sur le titre et l'infectiosité des virus qui infectent le foie (source la plus riche de PCSK9) 12 , comme le virus de l'hépatite C ( VHC). Les données ont montré que PCSK9 cible 2 récepteurs hépatiques du VHC pour la dégradation, à savoir le LDLR et la protéine tétraspanine CD81. 71 En outre, il a été récemment rapporté que d'autres virus se lient aux membres de la famille LDLR de surface cellulaire pour entrer et infecter les cellules, y compris le virus de la stomatite vésiculeuse qui utilise probablement le LDLR et le LRP1 comme récepteurs d'entrée. 72 Ces résultats suggèrent que bien que l'inhibition de PCSK9 puisse être bénéfique pour réduire les niveaux de LDL-C circulant, elle pourrait potentiellement augmenter l'infectiosité de certains virus, tels que le VHC, le virus de la stomatite vésiculeuse, le virus du rhinocéros du rhume et le virus du sarcome rous.

Il a été suggéré que PCSK9 pourrait améliorer la dégradation de certaines cibles dans le compartiment intermédiaire ER/ER-Golgi. Deux exemples ont été rapportés : (1) L'enzyme de clivage-1 de la protéine précurseur de l'aspartyl protéase -sécrétase -amyloïde associée à la maladie d'Alzheimer (BACE1) est acétylée de manière transitoire sur 7 résidus Lys dans la lumière du compartiment intermédiaire ER/ER-Golgi. Les intermédiaires acétylés de la protéine naissante sont capables d'atteindre l'appareil de Golgi, tandis que les non acétylés sont retenus et dégradés dans un compartiment post-ER. Il a été signalé que PCSK9 contribuait à l'élimination du BACE1 non acétylé. 73 Cette observation intéressante nécessite encore une validation in vivo.(2) Dans le deuxième exemple, dans le compartiment intermédiaire des cellules ER/ER-Golgi, il a été rapporté que PCSK9 améliore la dégradation du canal épithélial Na + (ENaC) qui est essentiel pour l'homéostasie Na + et le contrôle de la pression artérielle. 74 Cette observation était intrigante, surtout au vu de l'expression de PCSK9 dans le rein. 12 Cependant, nos données ont révélé que chez les souris knock-out pour PCSK9, l'augmentation de la pression artérielle basale et induite par l'angiotensine-II n'est pas différente des contrôles de type sauvage, suggérant que les niveaux d'EnaC ne sont pas sensiblement augmentés en l'absence de PCSK9, au moins dans souris (NG Seidah et T. Reudelhuber, données non publiées, 2014). Ces résultats jettent un doute quant à la pertinence physiologique du rôle cellulaire rapporté de PCSK9 sur le canal Na + épithélial. 74

Régulation des gènes de PCSK9

Régulation transcriptionnelle de l'expression PCSK9

Comme pour tout autre gène, la régulation de l'expression du gène PCSK9 commence à la transcription. Une analyse rigoureuse du promoteur proximal du gène PCSK9 (région en amont de 600 pb et premier exon) a été menée pour rechercher des éléments régulateurs transcriptionnels probables à l'aide de l'algorithme en ligne Nsite (http://linux1.softberry.com). Les caractérisations fonctionnelles de ces éléments se sont principalement concentrées sur l'humain et la souris. PCSK9 promoteur de gène.

Facteurs de liaison nucléaire

L'élément régulateur des stérols (SRE) est le plus conservé de ces motifs transcriptionnels, en accord avec un rôle modulateur de ce gène dans le métabolisme du cholestérol. SRE est le site de liaison des protéines de liaison SRE (SREBP), les principaux facteurs de transcription dans les voies de biosynthèse des lipides. Peu de temps après la découverte de PCSK9, une analyse impartiale du transcriptome hépatique de souris a montré que le niveau d'ARNm de PCSK9 était fortement régulé à la baisse lorsque les souris étaient nourries avec un régime riche en cholestérol et régulé à la hausse chez les souris transgéniques surexprimant SREBP-1a ou SREBP-2 nucléaire. 75 Plus tard, Dubuc et al 76 ont montré que les statines, qui inhibent la 3-hydroxy-3-méthyl-glutaryl-CoA réductase, l'enzyme limitant la vitesse de la biosynthèse du cholestérol, entraînant une rétroactivation de la SREBP-2 nucléaire, augmentaient le niveau de ARNm de PCSK9 dans des hépatocytes humains HepG2 en culture. L'induction des statines pourrait être abrogée par le mévalonate, un précurseur du cholestérol post-3-hydroxy-3-méthyl-glutaryl-CoA réductase, confirmant le lien de cette régulation avec le métabolisme du cholestérol. 76 SREBP-1c a également été impliqué dans la régulation positive postprandiale de l'insuline PCSK9 l'expression génique dans les hépatocytes car l'expression constitutive ou l'inactivation de ce facteur transcriptionnel a augmenté ou réduit le niveau d'ARNm de PCSK9 dans ces cellules en culture, respectivement. 77 SREBP-1 et SREBP-2 se sont avérés se lier spécifiquement au promoteur du gène PCSK9 SRE in vitro. 78

SREBP activation de la PCSK9 Le promoteur du gène est potentialisé par le facteur nucléaire hépatocytaire-1α (HNF1α), qui se lie à un élément situé à 28 nucléotides (nts) en amont du SRE. Ce site est conservé entre primate et rongeur PCSK9 promoteurs et est absent dans le LDLR promoteur. Son invalidation par mutagenèse dirigée réduit considérablement PCSK9 expression induite par le promoteur du gène d'un gène rapporteur dans des cellules HepG2 transfectées. 79 La régulation à la hausse de l'expression de HNF1α par les statines 80 contribue à une production/sécrétion soutenue de PCSK9 qui atténue la clairance médiée par le LDLR du LDL-C plasmatique induite par ces médicaments. Son expression est régulée à la baisse par la berbérine phytochimique 79 et par les activateurs de la voie de signalisation de la cible mécanistique hépatique du complexe 1 de la rapamycine (mTORC1), 81 faisant de ces composés des activateurs potentiels de la clairance du LDL-C.

Situé entre le motif de liaison SRE et HNF1α se trouve un motif de liaison au facteur nucléaire P(H1NFP) de l'histone 1 qui s'est avéré essentiel à la fonctionnalité du SRE dans le PCSK9 promoteur, étant requis à la fois pour l'activation basale et améliorée de ce promoteur par SREBP-2. En se liant à ce motif, H1NFP coopère avec la protéine nucléaire cofacteurs du locus muté de l'ataxie télanectasie et la protéine associée au domaine de transformation/transactivation pour activer le PCSK9 promoteur. La protéine associée au domaine de transformation/transactivation est un cofacteur de l'histone acétyltransférase, qui médie l'acétylation de l'histone H4 sur le promoteur, facilitant son activation. 82 Inversement, une acétylation ou une désacétylation altérée de l'histone au niveau du promoteur PCSK9 peut entraver son activation. La sirtuine 6, une histone désacétylase dépendante du NAD + est un répresseur transcriptionnel de la PCSK9 car son absence dans le foie de souris entraîne une augmentation de l'expression de ce gène, alors que sa surexpression la réduit. 83 Le facteur de liaison à l'élément sensible à l'insuline connu sous le nom de FoxO3 recrute la Sirtuine 6 PCSK9 promoteur, où il désacétyle l'histone 3 et provoque des changements locaux de la chromatine qui annulent l'activation du promoteur. Fait intéressant, l'élément de reconnaissance de FoxO3 est intégré à celui de HNF1α. Des interactions entre les 2 facteurs agissant de manière opposée ont été démontrées dans des études de co-immunoprécipitation. 83 Le résultat de cette interaction concurrentielle peut dépendre des quantités relatives de ces facteurs et de leurs cofacteurs requis.

Récepteurs nucléaires

Les PCSK9 Le promoteur est également régulé par des récepteurs nucléaires activés par des ligands, tels que le récepteur Farnesoid X et les récepteurs activés par les proliférateurs de peroxysomes (PPAR). Le récepteur farnésoïde X, qui se lie à l'acide chénodésoxycholique, a été impliqué dans la chute de l'ARNm de PCSK9 dans des cultures d'hépatocytes après exposition à ce composant d'acide biliaire. Cette implication est probablement indirecte car le knockdown induit par le siRNA du récepteur était inefficace. 84

Les agonistes de PPARα, tels que le fénofibrate, sont couramment utilisés pour traiter l'hypercholestérolémie et principalement l'hypertriglycéridémie. Leurs effets sur les niveaux d'ARNm de PCSK9 ont été explorés avec des résultats mitigés. Ils se sont avérés réprimer l'expression du gène PCSK9 dans une lignée cellulaire d'hépatocytes humains et des hépatocytes de souris isolés, 85,86, mais l'agoniste WY14643 n'a eu aucun effet sur le niveau d'ARNm de PCSK9 dans les hépatocytes de hamster isolés. 87 Les raisons de cet écart ne sont pas claires, tout comme celles des études cliniques menées chez des patients traités par fibrate, montrant une augmentation des taux plasmatiques de PCSK9 dans la plupart des études 88-91 et une diminution des taux dans une autre. 85

Il a été démontré que les ligands PPARγ, 15d-PGJ1 ou pioglitazone, augmentent le niveau d'ARNm de PCSK9 dans les cellules HepG2. Cette induction peut également être obtenue en empêchant la phosphorylation du récepteur par les kinases régulées extracellulairement 1 et 2 avec de tels inhibiteurs spécifiques PD98059 ou U0126. 92

Il est à noter que, dans ce réseau de régulation transcriptionnelle, les gènes SREBP-2 et HNF1α sont eux-mêmes souvent des cibles en aval d'autres facteurs. Par exemple, il a été démontré que l'activation de PPAR (α ou ) dans le foie, les hépatocytes ou les entérocytes réduit le niveau de SREBP-2 nucléaire et finalement de la biosynthèse du cholestérol. 93,94 mTOR1 régule également à la baisse HNF1α, entraînant une transcription PCSK9 réduite. 81 La sirtuine 6 avait des effets inhibiteurs similaires sur SREBP-2 et ses gènes cibles. 95,96 Ainsi, SREBP-2 et HNF1α semblent se situer à un carrefour de voies transcriptionnelles régulant l'expression de gènes qui pourraient influencer l'homéostasie du cholestérol intracellulaire, notamment PCSK9 et LDLR gènes.

Ainsi, la régulation à la hausse ou à la baisse de la transcription PCSK9 est déterminé par l'abondance relative et l'activité d'une variété de facteurs nucléaires agissant en coopération ou en compétition sur cis éléments réglementaires. Les éléments décrits ci-dessus sont situés dans le promoteur proximal, mais la possibilité d'éléments plus distaux ne peut pas encore être écartée. La fonctionnalité a été explorée principalement dans les cellules hépatiques. Une meilleure compréhension de la régulation transcriptionnelle peut permettre d'anticiper le sens de l'expression de PCSK9 dans ces cellules dans certaines conditions physiologiques ou thérapeutiques. En outre, cela peut expliquer pourquoi certaines mutations du gène apparenté sont associées à une expression altérée de la protéine, comme cela a été observé avec le variant c.-332C>A ​​situé près du SRE et associé à un phénotype GOF dans une population espagnole. 97

Régulation post-transcriptionnelle de l'expression PCSK9

La régulation de la stabilité de l'ARNm et la traduction en protéine sont des mécanismes de réponse plus immédiats aux demandes physiologiques que la transcription. À notre connaissance, il n'y a eu aucune preuve expérimentale de la régulation de l'expression de PCSK9 à ces niveaux. Cependant, les séquences de la région 3' non traduite (3'-UTR) de son ARNm présentent des caractéristiques suggérant une telle régulation. Les ARNm structurellement instables sont généralement caractérisés par une teneur élevée en AU dans leur 3'-UTR. 98 À l'extrémité de la 3′-UTR longue de 1,3 kb de la PCSK9 humaine, l'ARNm est un îlot de ≈120 nts (nts 575–3692 NM_174936.3), qui présente une teneur en UA de 71 %, contient 2 AUUUA canoniques riches en UA éléments couramment associés à l'instabilité de l'ARNm, et est relativement conservé chez les primates et les rongeurs. La pertinence de cet îlot AU dans la stabilité de l'ARNm reste à déterminer fonctionnellement. Ceci est encore justifié par le fait que l'ARNm du LDLR, le partenaire opposé de PCSK9 dans l'homéostasie lipidique, est lui-même, soumis à une régulation négative via sa 3'-UTR par la ribonucléoprotéine nucléaire hétérogène D. La reconnaissance du miARN-24 dans la 3'-UTR de l'ARNm de PCSK9 humain justifie une étude de son rôle régulateur possible, compte tenu des implications croissantes des miARN dans le métabolisme du cholestérol. 101

Modèles animaux PCSK9

Hypercholestérolémie et athérosclérose (modèles transgéniques)

L'expression à médiation adénovirale de la PCSK9 humaine chez la souris entraîne un phénotype intermédiaire LDLR-knockout. 38 L'effet PCSK9 s'exerce principalement de manière paracrine/endocrine, comme le montrent les expériences de parabiose. 102 Comme prévu, les souris transgéniques surexprimant PCSK9 sous un Apoe promoteur [Tg(Apoe-PCSK9)] sont viables, fertiles et sévèrement hypercholestérolémiques. 26,39 Il est intéressant de noter que bien que le LDLR ne soit pas détecté dans le foie de ces souris, le LDL-C circulant n'est augmenté que d'un facteur ≈5 par rapport à un facteur ≈15 chez Ldlr-souris knock-out. 26 Cela suggère que le LDLR dans les tissus autres que le foie contribue à la clairance du LDL-C circulant, et que le LDLR dans ces tissus extrahépatiques n'est pas régulé par ou accessible à la PCSK9 circulante. Les mécanismes possibles sont décrits dans la section ci-dessous décrivant le rôle de PCSK9 dans les tissus extrahépatiques.

Sur un Apoe-fond génétique knock-out, Tg(Pcsk9) les souris développent une athérosclérose accélérée avec une plus grande taille de plaque, lorsqu'elles sont nourries avec un régime alimentaire régulier, et un effet protecteur a été observé avec Pcsk9-souris knockout sur le même fond. 31 Les complications tardives de l'athérosclérose sous forme de plaques calcifiées vasculaires ont également été observées chez ces Apoe-knockout/Tg(Pcsk9) souris mais à un degré moindre et avec une latence plus longue par rapport à Ldlr-souris knock-out. 103 Ainsi, ces souris Tg(PCSK9) déficientes en ApoE présentent un phénotype intermédiaire à l'absence totale du LDLR et sont donc plus pertinentes pour la majorité des individus ayant une activité LDLR atténuée et une dyslipidémie. Enfin, l'hypercholestérolémie et l'athérosclérose ont été récapitulées dans un modèle porcin d'un mutant humain PCSK9 GOF D374Y. Une expression spécifique du foie de ce mutant chez les miniporcs a entraîné des niveaux nettement réduits de LDLR hépatique, une altération de la clairance du LDL-C, une hypercholestérolémie sévère, et finalement ces miniporcs ont développé des lésions athéroscléreuses progressives spontanées qui pouvaient être visualisées par imagerie non invasive. 104 Deux conclusions peuvent être tirées de ces observations : premièrement, l'inhibition de PCSK9 serait une modalité thérapeutique potentielle deuxièmement, l'utilisation de modèles de grandes espèces fera mieux avancer l'aspect recherche translationnelle du traitement de l'athérosclérose de l'animal à l'homme. 104

Hypocholestérolémie et métabolisme des graisses (modèles knock-out)

Une des expériences classiques visant à comprendre les fonctions d'un gène donné est de le supprimer du génome et d'observer les conséquences d'une telle absence d'expression. Compléter Pcsk9-knockout a donné lieu à des souris viables et fertiles présentant une hypocholestérolémie sévère, 25,26 avec une baisse ≈ 40 % et ≈ 80 % du cholestérol total et du LDL-C, respectivement. 18 En comparaison, spécifiques du foie Pcsk9Les souris knock-out présentent ≈27 % de cholestérol circulant en moins, ce qui suggère que la PCSK9 du foie contribue à ≈70 % du phénotype du cholestérol. 18 Il est intéressant de noter que la perte spécifique du foie de l'expression de PCSK9 26 a entraîné son absence totale de la circulation, démontrant que les hépatocytes sont la principale source de PCSK9 plasmatique. 65 Notamment, les analyses lipidomiques du plasma de Pcsk9-knockout et des souris transgéniques ont révélé que Pcsk9Les souris knock-out entraînent une réduction marquée des taux plasmatiques de sphingomyéline et de céramides, qui sont des facteurs de risque connus de maladie coronarienne. 105 Ces biomarqueurs lipidiques devraient désormais également être mesurés dans le plasma des patients traités par des inhibiteurs de la biosynthèse du cholestérol (par exemple, les statines) ou des médicaments anti-PCSK9 pour évaluer l'efficacité du traitement car il a également été montré que des réductions similaires sont observées dans le plasma de les individus porteurs de la mutation R46L LOF 105 ou ceux traités par la simvastatine. 106

Comme mentionné ci-dessus, PCSK9 peut cibler d'autres récepteurs, et le VLDLR est régulé à la hausse dans les dépôts périgonadiques des femelles. Pcsk9-souris knock-out. En conséquence, les adipocytes sont devenus hypertrophiques en raison de niveaux plus élevés de VLDLR adipocytaire et d'une absorption accrue de FFA, 65 éventuellement via un niveau accru de CD36 associé. 70 Inversement, les triglycérides plasmatiques étaient légèrement augmentés Pcsk9-knockout mâles (+35% non significatif) et femelles (+46% P=0,03). En outre, des études in vivo ont révélé que le déficit en PCSK9 était associé à une diminution de 2 fois des taux de triglycérides postprandiaux, suggérant une amélioration de la clairance des triglycérides et un rôle de PCSK9 dans le métabolisme des triglycérides, 107 probablement via sa capacité à améliorer la dégradation du VLDLR et du CD36. PCSK9 est donc essentiel dans le métabolisme des graisses car il maintient des niveaux élevés de LDL-C circulant via la dégradation hépatique du LDLR, mais en même temps, il régule à la baisse l'entrée des triglycérides et des FFA dans les adipocytes viscéraux, éventuellement via la dégradation du VLDLR 65 et du CD36 du tissu adipeux. 69

Rôle de PCSK9 dans les tissus extrahépatiques

Adipocytes, muscles et myocytes

PCSK9 est principalement exprimé dans le foie adulte, l'intestin grêle, les reins, 12,26 et le pancréas. 12 108 Bien qu'elle ne soit pas exprimée dans les adipocytes, la PCSK9 circulante produite par le foie peut réguler les niveaux de récepteurs de surface cellulaire dans ce tissu. 65 Étant donné que la PCSK9 humaine cible le VLDLR 42 humain ex vivo et se lie au VLDLR de souris in vitro, 43 la PCSK9 a la capacité de cibler le VLDLR humain in vivo. En effet, la graisse viscérale s'accumule chez les souris déficientes en PCSK9 en raison de l'absorption élevée de chylomicrons et de VLDL-C dans les tissus qui expriment principalement le VLDLR (comme le tissu adipeux suivi du cœur et des muscles). Le manque de PCSK9 augmente l'expression de surface du VLDLR qui facilite l'hydrolyse des triglycérides et l'absorption des FFA dans les adipocytes viscéraux. En théorie, les tissus musculaires et cardiaques auraient également été touchés, mais les muscles brûlent les graisses en continu, tandis que les tissus adipeux ont tendance à stocker de l'énergie sous forme de gouttelettes de graisse pour une utilisation ultérieure. L'absence de PCSK9 chez la souris ou de variantes LOF PCSK9 chez l'homme est suggérée pour affecter la lipémie postprandiale, 107 ce qui établit en outre l'association entre la PCSK9 sérique et le métabolisme des lipides. Au moins dans Pcsk9-souris knock-out, aucune régulation positive des cytokines, associée au syndrome métabolique, n'a été observée. 65 Il reste à élucider si un dépôt accru de graisse viscérale se produit également chez les humains dépourvus de PCSK9 fonctionnel. La graisse périgonadique fait partie de ce qu'on appelle le tissu adipeux viscéral, qui est directement corrélé aux maladies métaboliques liées à l'obésité et aux maladies coronariennes. Cependant, il a été récemment rapporté que chez les patients obèses avec des niveaux similaires de tissu adipeux viscéral, les complications métaboliques étaient plus fréquentes chez ceux présentant des triglycérides intrahépatiques plus élevés. 109 Dans une perspective clinique, car Pcsk9-les souris knock-out ne développent pas de stéatose hépatique 26 et ne sont pas sujettes à l'obésité, l'administration d'un inhibiteur de PCSK9 pour le traitement de l'hypercholestérolémie ne devrait pas entraîner d'effets indésirables.

Surrénales et reins

Comme le foie, les glandes surrénales nécessitent la synthèse et l'absorption de cholestérol pour fonctionner correctement. Il a été constaté que l'annexine A2 est un inhibiteur extrahépatique naturel de PCSK9 110 et que dans Anxa2chez les souris knock-out, la PCSK9 plasmatique double et le LDLR diminue d'environ 50 % dans certains tissus extrahépatiques, tels que les surrénales, l'intestin grêle et le côlon, mais pas dans le foie. 111 De plus, les souris transgéniques exprimant la PCSK9 humaine principalement dans le rein ont entraîné une dégradation du LDLR principalement dans le foie mais pas dans les surrénales. 112,113 Ainsi, il est probable que les niveaux élevés d'annexine A2 dans les glandes surrénales soient responsables de la réfractarité du LDLR dans ce tissu à l'action de PCSK9. 110,111 Une autre possibilité, non mutuellement exclusive, est que dans les tissus réfractaires, tels que les glandes surrénales, le complexe [PCSK9≡LDLR] pénètre dans les endosomes mais ne se dirige pas vers les lysosomes et peut en fait se recycler à la surface cellulaire. En conséquence, une explication possible de l'activité tissu-spécifique de PCSK9 pourrait être que les tissus extrahépatiques qui ne répondent pas à PCSK9 sont incapables de trier le complexe [PCSK9≡LDLR] en lysosomes, probablement en raison d'une réponse cellulaire défavorable ou de l'absence de protéine spécifique fonctionnelle. (s) qui contrôlent le ciblage lysosomal du complexe (Figure 2). À l'appui de cette notion, il a été récemment montré que les fibroblastes, qui sont résistants à la dégradation du LDLR induite par PCSK9, peuvent se lier à PCSK9 mais que le PCSK9 endocyté se dissocie du LDLR au sein des endosomes précoces, et ce dernier est rapidement recyclé vers le surface cellulaire et non envoyé aux lysosomes pour dégradation. 114 Alternativement, certains tissus, tels que les glandes surrénales, sont enrichis en un inhibiteur endogène de PCSK9 (par exemple, l'annexine A2), qui empêche sa fonction sur le LDLR. 111

Le rôle physiologique de PCSK9 dans le rein n'est toujours pas clair, notamment parce que son expression y passe du cortex de l'embryon à la lumière des rongeurs adultes. 12 Il est également possible que PCSK9 agisse localement dans certains tissus extrahépatiques qui expriment cette protéine (par exemple, l'intestin grêle, le pancréas et les reins), et que ses niveaux circulants n'affectent pas le LDLR dans ces tissus. La possible dégradation induite par PCSK9 du canal Na + épithélial dans les cellules rénales 74 doit être confirmée in vivo car la pression artérielle basale et l'augmentation de la pression artérielle induite par l'angiotensine-II chez la souris ne sont pas modifiées par le manque d'expression de PCSK9 (NG Seidah et T Reudelhuber, données non publiées, 2014).

Intestin grêle et pancréas

Les résultats des expressions cellulaires et tissulaires du rat, de la souris et de l'homme ont montré que non seulement le foie et le cervelet sont riches en PCSK9, mais également l'intestin grêle, en particulier l'iléon.12 La régulation PCSK9 des niveaux de protéines LDLR dans les lignées cellulaires intestinales a été rapportée. 69,115 L'implication possible de PCSK9 dans l'excrétion inverse transintestinale du cholestérol à partir de l'intestin grêle a été récemment évoquée. 116 Bien que le LDLR soit impliqué dans ce processus, il semble qu'un ou plusieurs autres récepteurs sensibles à PCSK9 soient également impliqués. 116 Ce récepteur pourrait-il être l'une des cibles connues de PCSK9, comme VLDLR, apoER2, LRP1, CD36, ou encore un autre récepteur à identifier dans le futur ? Enfin, il a été rapporté que la séquence N-terminale chargée négativement du prosegment de PCSK9 est critique pour la liaison du [prosegment≡PCSK9] au LDL-C (probablement à une séquence chargée positivement dans ApoB). 60 Étant donné que le foie exprime principalement l'ApoB-100 et l'ApoB-48 de l'intestin grêle, et que cette dernière ne se lie pas au LDLR, il est possible que la différence entre le foie et l'intestin grêle en ce qui concerne la réactivité à la PCSK9 circulante soit affectée par ces 2 isoformes d'ApoB.

PCSK9 a été initialement observé comme étant fortement exprimé dans les lignées de cellules β pancréatiques. 12 Par rapport aux témoins, les hommes plus âgés Pcsk9Les souris knock-out expriment plus de LDLR dans les cellules des îlots pancréatiques et sont intolérantes au glucose. 108 Il reste à voir si la PCSK9 circulante affecte le LDLR et d'autres récepteurs à la surface des cellules , et si la régulation positive de ceux-ci en l'absence de PCSK9 endogène ou de la circulation entraîne une lipotoxicité ou une altération de la fonction des cellules .

PCSK9 et conditions pathologiques

Régénération du foie

Étant donné que PCSK9 est principalement produite par le foie et que ce dernier est un organe de régénération, il était attendu que des conditions qui perturbent la fonction hépatique puissent influencer les niveaux de PCSK9 et que ces derniers puissent à leur tour affecter la capacité du foie à se remettre de certaines agressions. Des études in vivo ont révélé qu'après une hépatectomie partielle, la régénération du foie de Pcsk9Les souris knock-out présentaient la présence de lésions nécrotiques et un retard important dans leur capacité de régénération. 26 Heureusement, ce phénotype de lésion et cette capacité de régénération ont été inversés lorsqu'un régime riche en cholestérol a été complété aux souris avant et après une hépatectomie partielle. 26 Ces résultats ont été la première indication que sur les dommages hépatiques, les patients dépourvus de PCSK9 pourraient être à risque. Cependant, dans des circonstances normales, l'accumulation de lipides dans les hépatocytes de ces souris a été nettement réduite sous les régimes alimentaires réguliers et riches en cholestérol, révélant que la carence en PCSK9 confère une résistance à la stéatose hépatique. 26 En conclusion, bien que l'inhibition de PCSK9 puisse protéger contre le développement de la stéatose hépatique, elle peut également entraîner un risque accru de lésions hépatiques après une agression hépatique. Il reste à voir quels types d'insultes sont plus délétères à la fonction hépatique en l'absence de PCSK9 (par exemple, hépatite, cirrhose du foie ou carcinome hépatocellulaire).

Résistance à l'insuline

Les souris mâles adultes déficientes en PCSK9 présentent une tolérance au glucose altérée et peuvent être à risque de développer un diabète sucré en vieillissant. 108 Cependant, le mécanisme sous-jacent est largement inconnu. Dans 1 étude de population, il a été montré que les sujets avec PCSK9 LOF R46L ont une augmentation significative des marqueurs de la résistance à l'insuline, à savoir l'insuline, l'évaluation du modèle d'homéostasie de la résistance à l'insuline et l'hormone adipokine leptine chez les individus porteurs d'une copie d'apoE2 par rapport à ceux portant d'autres isoformes d'apoE. 117 Cela indique que le LOF hétérozygote de APOE et PCSK9 peut conduire à une résistance à l'insuline. À ce jour, la seule femme analysée qui manque complètement de PCSK9 en raison de mutations nulles hétérozygotes composées 23 n'a pas été signalée comme ayant une résistance à l'insuline.

Infections virales

Les particules du VHC interagissent avec un certain nombre de récepteurs putatifs du VHC, notamment le CD81, le récepteur piégeur de classe B de type I et le Claudin-1. 118 Les particules de VHC circulantes sont associées aux VLDL et aux LDL des patients infectés, ce qui suggère que le LDLR est essentiel pour l'infection virale hépatique. Récemment, il a été montré que l'expression hépatique de CD81 est nettement augmentée dans Pcsk9-knockout et que la protéine CD81 du récepteur du VHC est régulée à la baisse indépendamment du LDLR. 71 Par conséquent, il a été proposé que le niveau plasmatique et l'activité de PCSK9 pourraient moduler l'infectiosité du VHC chez l'homme. En résumé, les récepteurs d'entrée du VHC LDLR et CD81, 2 sont régulés à la baisse en fonction de la dose par PCSK9, ce qui entraîne la réduction de l'infectivité cellulaire du VHC chez la souris. Bien qu'il n'ait encore jamais été démontré chez l'homme, PCSK9 a le potentiel de protéger contre le VHC. Par conséquent, des précautions doivent être prises lors de l'administration d'inhibiteurs de PCSK9 à des sujets qui pourraient être potentiellement infectés par le VHC ou d'autres virus qui utilisent ≥1 des membres de la superfamille LDLR comme récepteurs d'entrée. 72

Modulation physiologique des niveaux PCSK9

Variation avec l'âge, le sexe et la grossesse

Une étude pédiatrique transversale portant sur ≈ 1700 sujets a révélé que chez les garçons, les taux plasmatiques de PCSK9 diminuaient continuellement de 9 à 16 ans, en corrélation avec les taux moyens de cholestérol total qui diminuaient continuellement avec l'âge. En revanche, chez les filles, les niveaux de PCSK9 ont culminé à l'âge de 13 ans, puis ont diminué pour atteindre des niveaux plus élevés que ceux des garçons à 16 ans, et les niveaux de cholestérol total étaient plus élevés chez les 9 et 16 ans que chez les 13 ans. 119 On pense que cette régulation suit un modèle d'hormone de croissance. 119 Dans l'étude multiethnique Dallas Heart Study portant sur 3138 patients, les taux plasmatiques de PCSK9 étaient significativement plus élevés chez les femmes (n=1863) que chez les hommes (n=1489). Cette différence a persisté après ajustement pour la plupart des variables. 120 Dans la même étude, les femmes préménopausées présentaient des taux plasmatiques de PCSK9 considérablement plus élevés que les femmes ménopausées. Le traitement aux œstrogènes n'a pas affecté de manière significative les niveaux de PCSK9 à jeun chez les femmes ménopausées. En comparaison, il n'y avait pas de différence dans les taux plasmatiques de PCSK9 chez les hommes >50 par rapport à ceux <50 ans. Des résultats similaires ont été obtenus chez les hommes plus âgés et les femmes ménopausées, avec des taux de PCSK9 plus élevés de 9 % à 14 % observés chez les femmes. Enfin, les taux sériques de PCSK9 ont augmenté pendant la grossesse à terme. Cependant, des données récentes ont également montré que le fœtus humain a des niveaux de PCSK9 ≈ 2 fois inférieurs à ceux de la mère, ce qui peut être nécessaire pour fournir du LDL-C au fœtus en croissance. 121

Variation avec l'alimentation et les médicaments

Il a été constaté qu'un régime méditerranéen de 5 semaines chez des sujets normaux peut réduire le LDL-C plasmatique et le PCSK9 jusqu'à ≈ 10 % et ≈ 15 %, respectivement. 122 De plus, il a été montré que la transcription de PCSK9 pouvait être supprimée par le jeûne et induite par l'insuline, probablement en activant le récepteur X du foie et SREBP-1c. 77 Comme le LDLR, PCSK9 est également régulée à la hausse par la déplétion intracellulaire en stérols et le traitement aux statines. Ainsi, dans les lignées cellulaires hépatiques, les statines ont régulé positivement de manière coordonnée l'expression de l'ARNm de LDLR et de PCSK9. 76 Cela suggère que les statines auraient une plus grande capacité à diminuer le LDL-C si ce n'était de l'augmentation associée du niveau de PCSK9 après la statine. En effet, le traitement aux statines de Pcsk9Les souris knock-out entraînent une réduction plus élevée du LDL-C que celle des souris de type sauvage, ce qui signifie un état d'hypersensibilité. 25 Cela a été confirmé chez les personnes atteintes d'HF hébergeant la variante commune LOF R46L qui semblent être plus sensibles à la statine. 123 Bien que les statines augmentent directement l'expression de l'ARNm de PCSK9, les agonistes de PPARα, tels que les fibrates, affectent indirectement l'expression de PCSK9 en modulant les taux de cholestérol. 88 Dans un essai randomisé, bien qu'il ait été démontré que les statines augmentaient les niveaux de PCSK9 circulante, l'inhibiteur de l'absorption du cholestérol, l'ézétimibe, n'avait aucun effet sur la PCSK9. 124 Enfin, dans une étude dans laquelle des femmes ont subi une fécondation in vitro, des taux élevés d'œstrogènes ont entraîné une réduction des taux de VLDL, LDL et PCSK9. 125 Cependant, cela pourrait avoir été un effet de la multiplication par 3 de l'hormone de croissance en réponse à l'induction de l'ovulation. Ainsi, l'hormone de croissance peut affecter négativement PCSK9 pour favoriser une absorption accrue du cholestérol circulant par les cellules en croissance.

Variance génétique PCSK9

Des études familiales de patients atteints de maladie coronarienne ont conduit à la cartographie des PCSK9 gène à FH, avec des mutations GOF présentant des taux sériques élevés de LDL-C 14, de même que des mutations LOF se sont avérées plus tard réduire le LDL-C et pourraient protéger contre les maladies coronariennes. 18 Jusqu'à présent, seules 2 femmes étaient totalement dépourvues de PCSK9 et présentaient de faibles taux de LDL-C circulant : un sujet présentant des mutations hétérozygotes composées LOF 23 et 1 mutation homozygote LOF C679X. 24 Une liste continuellement mise à jour de toutes les mutations naturelles de PCSK9 est disponible sur (http://www.ucl.ac.uk/ldlr/LOVDv.1.1.0/index.php?select_db=PCSK9), et certaines d'entre elles ont été récemment résumé. 126

Mutations naturelles déterminant les niveaux de PCSK9

En dépistant une cohorte hypercholestérolémique d'individus dépourvus de mutations dans le LDLR et APOB, cas d'HF attribués à PCSK9 les mutations ont été estimées à ≈2 % des patients atteints d'HF. 14,30 Cependant, comme le LDLR est la principale voie d'absorption de PCSK9, ses taux circulants sont plus élevés chez les patients atteints d'HF avec LOF LDLR mutations, qui peuvent contribuer au large spectre de FH. 127 PCSK9 GOF a été associé à une sévérité accrue de l'athérosclérose coronarienne chez les patients atteints d'hypercholestérolémie polygénique. 128 Les taux plasmatiques de PCSK9 sont augmentés non seulement chez les patients atteints d'HF mais également chez les patients atteints d'hypercholestérolémie familiale combinée. 129 Ceux-ci suggèrent que de rares mutations faux-sens dans PCSK9 peut aggraver le phénotype clinique des patients porteurs LDLR mutations. De même, le APOE génotype influencera le phénotype lipidique de PCSK9 mutations comme suggéré dans 1 étude, avec un accent particulier sur le génotype E3/E2. 117

Variations avec des mécanismes exceptionnels

Certaines mutations ont permis une meilleure compréhension de la biosynthèse et de la sécrétion de la biologie de PCSK9 et méritent d'être soulignées. (1) La mutation canadienne-française LOF Q152H empêche le traitement autocatalytique de proPCSK9, ce qui entraîne une forme négative dominante de la protéine qui, à l'état hétérozygote, réduit les taux circulants de PCSK9 et de LDL-C jusqu'à ≈ 80 % et ≈ 50 %, respectivement. 22 Ce mécanisme a été confirmé par la suite après une analyse exhaustive de tous les Gln possibles152 mutations. 34 (2) Curieusement, la mutation GOF R218S diminue de manière significative le catabolisme de PCSK9, lui permettant de circuler plus longtemps et d'affecter négativement le LDLR pour favoriser un taux de cholestérol élevé. 130 Cela est probablement dû à la résistance de ce mutant à l'inactivation de la furine. 63 (3) À l'inverse, la mutation LOF A443T 19 entraîne probablement un nouveau site de O-glycosylation PCSK9 qui favorise la dégradation de la protéine induite par la furine. 63 (4) La mutation GOF anglo-saxonne la plus sévère D374Y, 20 qui, malgré des taux circulants plus faibles, entraîne une affinité de liaison 10 à 25 fois plus élevée de PCSK9 au LDLR. 36 (5) Quelques variations de PCSK9 ont également été rapportées dans la région charnière (Figure 2, par exemple, la mutation LOF R434W entraînant des niveaux de sécrétion inférieurs de PCSK9 et des niveaux de LDL-C circulants réduits, probablement en raison d'un effet négatif sur le repliement de la protéine dans le RE). 131 (6) D'un autre côté, la mutation LDLR GOF H306Y dans le domaine EGF-A associée à la liaison à PCSK9 entraîne une dégradation cellulaire accrue médiée par PCSK9. 132

Thérapies basées sur PCSK9 et considérations de sécurité

Les entreprises se précipitent pour développer un médicament qui imite les effets du LOF PCSK9 mutations. Comme mentionné précédemment, PCSK9 améliore la dégradation post-traductionnelle du LDLR, diminuant ainsi sa capacité à abaisser le LDL-C. Cela fait de PCSK9 une cible thérapeutique prometteuse 6,30 et plusieurs sociétés pharmaceutiques dans le cadre d'essais cliniques ou précliniques actifs testent diverses approches pour inhiber PCSK9. 15 133 134 La meilleure approche à ce jour est l'utilisation d'un anticorps monoclonal (mAb) contre PCSK9 qui bloque sa liaison au LDLR, via un mécanisme allostérique. Les anticorps ciblés contre PCSK9 ont montré une baisse remarquable du cholestérol chez les souris et les singes, où une seule injection entraîne une réduction étonnante des taux de LDL-C d'environ 80 % pendant plus d'une semaine. 67

Des essais cliniques de phase I et II chez l'homme ont été menés par de nombreuses sociétés pharmaceutiques comme Sanofi/Regeneron et Amgen. Les essais de phase I ont confirmé l'innocuité et l'efficacité. Dans les essais de phase II, les deux sociétés rapportent une réduction du LDL-C variant entre 60 % et 70 % lors de l'injection sous-cutanée de ≈ 140 à 150 mg de mAb toutes les 2 semaines, sans élévation significative des enzymes hépatiques. 15,133 Il est intéressant de noter que la combinaison de 80 mg d'atorvastatine avec un mAb PCSK9 de 150 mg n'a eu aucun effet de réduction supplémentaire de >7% sur le LDL-C obtenu par le mAb seul. 135 Cependant, nous devrons attendre les résultats de l'administration à long terme d'un AcM avec ou sans statine avant de décider si une monothérapie d'AcM est suffisante. Comme avantage supplémentaire, ces mAb ont également réduit d'environ 30 % les niveaux de Lp(a) hautement athérogène, suggérant que PCSK9 cible également le(s) récepteur(s) hépatique(s) Lp(a) pour la dégradation. La réduction 2 fois plus faible de la Lp(a) circulante par un mAb PCSK9 par rapport au LDL-C suggère que le récepteur >1 Lp(a) existe, 136 dont l'un peut être ciblé pour la dégradation par PCSK9. L'identification du ou des récepteurs supposés sensibles à PCSK9 et du ou des segments qui interagissent avec PCSK9 aura sûrement un effet important sur notre compréhension de la biologie de Lp(a) et de PCSK9. En outre, étant donné que la réduction de Lp(a) est actuellement limitée à l'utilisation d'oligonucléotides antisens à l'ARNm d'ApoB ou à l'aphérèse, 136 définissant le récepteur Lp(a) sensible à PCSK9 améliorera sûrement les thérapies antiathérogènes actuelles. Le mAb qui passera à l'application clinique de routine dépendra des données de sécurité à long terme, de la facilité d'administration et du prix. 126 Le tableau en ligne I résume certains des résultats d'essais cliniques passés et en cours. Bien que les injections ne soient pas particulièrement attrayantes pour un traitement à vie, une telle approche serait probablement adoptée par les patients présentant des effets secondaires des agents hypolipidémiants actuels ou par des sujets à haut risque s'efforçant d'obtenir un taux de LDL-C plus faible, comme indiqué par des directives récentes. 137,138 Par exemple, les patients homozygotes atteints d'HF, pour lesquels les taux initiaux de LDL-C commencent ≈ 3 à 4 fois ceux de la population générale, sont généralement incapables d'obtenir une réduction de 50 % sur les agents oraux disponibles et nécessitent donc une LDL-aphérèse, une forme de dialyse pour éliminer le LDL-C du sang 139 Étonnamment, l'administration d'un mAb PCSK9 bloquant à des patients homozygotes atteints d'HF avec une certaine activité LDLR résiduelle a entraîné une réduction ≈ 30 % du LDL-C, 140 donnant un nouvel espoir pour ces patients qui ont subir souvent une aphérèse.

Une autre approche pour inhiber l'interaction extracellulaire PCSK9-LDLR consiste à utiliser des adnectines inhibitrices spécifiques de PCSK9. En effet, Bristol-Myers Squibb et Adnexus étudient actuellement l'efficacité d'une telle approche dans des études cliniques de phase I. Les adnectines isolées sont similaires aux mAb (qui sont 150 kDa), mais de plus petite taille (≈ 12 kDa), et comprennent un échafaudage du dixième domaine extracellulaire de fibronectine humaine de type III qui expose une boucle de liaison PCSK9.

Parce que PCSK9 améliore la dégradation du LDLR par une voie intracellulaire et extracellulaire (Figure 2), 48 et à moins que le foie utilise principalement la voie extracellulaire, une approche thérapeutique qui bloque les deux processus peut être plus efficace qu'une inhibant uniquement la voie extracellulaire, comme avec les AcM. L'utilisation d'oligonucléotides antisens devrait abroger les deux voies car elle réduit directement les niveaux d'ARNm de PCSK9. Cependant, les deux petits oligonucléotides antisens phosphorothioate modifiés au 2′-0-méthoxyéthyle 141 et les oligonucléotides antisens à acide nucléique verrouillé (LNA) 142 143 contre PCSK9 ont connu un début difficile. Bien que des résultats prometteurs aient été obtenus chez la souris et le singe, les deux essais cliniques de phase I ont dû être interrompus raisons inconnues) probablement en raison d'effets secondaires graves. Ainsi, bien que le LNA antisens, qui cible à la fois la PCSK9 humaine et la souris avec une efficacité similaire pour réduire la PCSK9, la toxicité rénale 142 a conduit à l'arrêt du traitement PCSK9 ciblant le LNA dans d'autres essais cliniques. 144

Un petit essai clinique sur les ARN interférents (ARNsi) impliquant PCSK9 ciblant les ARNsi a été évalué dans une étude d'escalade de dose de phase 1 randomisée, en simple aveugle, contrôlée par placebo chez des volontaires adultes en bonne santé présentant un taux de LDL-C sérique ≥ 3·mmol/ L ou supérieur. 145 Les données ont montré qu'à une dose de 0,4 mg/kg, ce traitement relativement sûr a entraîné une réduction moyenne de 70 % de la protéine plasmatique PCSK9 circulante et une réduction moyenne de 40 % du LDL-C par rapport à la valeur initiale par rapport au placebo. Des essais cliniques de phase II sont en cours. Bien que les mAb semblent bloquer près de 100 % des PCSK9 en circulation libre, l'approche siRNA laissait encore ≈ 30 % de PCSK9 en circulation, ce qui suggère une efficacité limitée de la méthode actuelle des siRNA. Bien qu'une comparaison directe de cette approche avec celle des mAb reste à tester chez l'homme, l'efficacité de la réduction du LDL-C observée avec les siRNA (40 %) 145 n'est toujours pas meilleure que celle obtenue avec les mAb (50 %– 70%). 15,133 Il est donc possible que la voie intracellulaire dans le foie puisse avoir une contribution relativement mineure à l'activité globale de PCSK9 sur LDLR.

D'autres approches anti-PCSK9 peuvent impliquer l'utilisation de protéines de fusion Fc soit au prosegment PCSK9, 146 ou même au domaine R1 de l'annexine A2. 111 Aucune des approches thérapeutiques anti-PCSK9 publiées chez l'homme n'a utilisé un inhibiteur à petites molécules, peut-être en raison de la planéité relative de la surface d'interaction du complexe [PCSK9≡LDLR], et donc de l'absence d'un sillon ciblable qui pourrait accueillir un inhibiteur de petite molécule. 30 Cependant, nous devrons attendre les résultats de certaines nouvelles approches pour l'identification et le test d'inhibiteurs à petites molécules, y compris ceux qui bloquent soit l'interaction de PCSK9 avec le LDLR en utilisant des mimétiques EGF-A 147 ou empêchent l'autotraitement de proPCSK9 et le sécrétion de PCSK9, 6 mimant ainsi les mutants dépourvus soit d'un résidu de site actif, 12 la mutation C672X 34 ou la mutation Q152H. 22,34 Ces nouvelles approches peuvent surmonter les obstacles à la thérapie par petites molécules, surtout si elles aboutissent à un inhibiteur actif par voie orale de la PCSK9 hépatique.

Étant donné que PCSK9 semble cibler un certain nombre de membres de la famille LDLR pour la dégradation, dont certains agissent comme des récepteurs d'entrée pour les virus infectieux, il est recommandé que les individus porteurs d'une infection virale soient soigneusement surveillés pour les titres viraux ou exclus du traitement à base d'anti-PCSK9. . De plus, compte tenu de l'importance critique de PCSK9 dans la régénération hépatique, les patients subissant une résection hépatique ne doivent pas prendre de médicaments anti-PCSK9. De plus, l'administration chronique d'un traitement anti-PCSK9 chez les patients doit être surveillée afin de détecter l'apparition possible d'une résistance à l'insuline et d'une intolérance au glucose. Cependant, il faut noter que l'intolérance au glucose n'était à ce jour observée que chez les mutants génétiques à LOF global, y compris les mâles. Pcsk9-des souris knock-out 108 et des humains porteurs du variant R46L. 117 L'utilisation d'un mAb peut ne pas avoir des effets similaires chez l'homme.À ce jour, avec le traitement à court terme (de 12 semaines à 1 an) avec un mAb ou un siRNA, aucune preuve n'a été rapportée pour le développement du diabète sucré de type II. Cependant, l'étalon-or pour tester l'intolérance au glucose à l'aide d'un test de glucose oral n'a pas encore été signalé. Enfin, comme chez la souris PCSK9 cible VLDLR, 42,65 apoER2, 42 et CD36, 70 la réduction des concentrations circulantes de PCSK9 peut augmenter les niveaux de ces récepteurs dans les tissus adipeux et autres, ce qui peut affecter la clairance des FFA. Des méthodes telles que les rapports taille/hanches ou les techniques d'imagerie devraient être mises en œuvre pour évaluer le degré d'adiposité viscérale pouvant résulter de la thérapie anti-PCSK9.

Conclusion

Avec la découverte de PCSK9 en 2003, le domaine lipidique a pris un tournant décisif, les inhibiteurs de PCSK9 devenant une réalité thérapeutique indéniable (Figure 3). La base moléculaire de l'action de PCSK9 prend en charge un modèle dans lequel PCSK9 est auto-clivé, sécrété et étroitement lié au domaine de type EGF-A du LDLR. Cela réduit le recyclage du LDLR et régule à la baisse l'activité du LDLR, augmentant ainsi les niveaux de LDL-C dans le sang. Ainsi, PCSK9 joue un rôle clé dans l'homéostasie du cholestérol. Les humains présentant des niveaux élevés de mutations PCSK9 ou GOF ont des niveaux accrus de LDL-C plasmatique et un risque cardiovasculaire considérablement accru au cours de leur vie. Les humains présentant de faibles niveaux de mutations PCSK9 ou LOF ont des niveaux réduits de LDL-C plasmatique et un risque significativement plus faible de développer une maladie cardiovasculaire. De plus, PCSK9 présente des effets métaboliques pléiotropes qui doivent être explorés plus avant. Le traitement par statine entraîne une augmentation des taux plasmatiques de PCSK9 mais une baisse globale des taux de LDL-C. Cela suggère que l'abaissement des niveaux de PCSK9 peut améliorer l'efficacité des statines pour réduire le LDL-C. Les modèles animaux se sont avérés inestimables pour dépister la modalité d'un nouveau médicament car l'athérosclérose et la calcification vasculaire sont améliorées chez les souris transgéniques surexprimant PCSK9 et réduites en Pcsk9-souris knock-out. Chez l'homme, la perte d'une copie de PCSK9 prévient 88 % des événements cardiovasculaires dans l'essai ARIC (Atherosclerosis Risk in Communities) sur >3000 individus suivis >15 ans. 21 Ainsi, PCSK9 est une cible claire pour le développement de nouvelles thérapies hypolipémiantes. L'inhibition de PCSK9 induite pharmacologiquement réduit efficacement les taux de LDL-C et améliore d'autres paramètres lipidiques, tels que les céramides et la Lp(a). Les anticorps monoclonaux sont actuellement les inhibiteurs de PCSK9 les plus avancés en termes de développement pharmacologique et de réponse clinique. Des études à long terme établiront si les effets bénéfiques de l'inhibition de PCSK9 sur les taux de LDL-C se traduisent directement par une réduction sûre et efficace du risque de MCV. Malgré son apparente sécurité, l'inhibition de PCSK9 suscite des inquiétudes car nous en savons encore peu sur ses fonctions physiologiques globales. Néanmoins, depuis la découverte du LDLR et son importance dans l'hypercholestérolémie et la régulation par les statines, il y a bien longtemps qu'une nouvelle piste a vu le jour pour réduire substantiellement le taux de cholestérol. La prise de conscience qu'une mutation complète de LOF PCSK9 et une inhibition de la PCSK9 plasmatique entraînent des taux de cholestérol au plus bas suggère que les inhibiteurs de PCSK9 pourraient être le prochain médicament à succès pour lutter contre l'hypercholestérolémie, ce qui serait un signe avant-coureur des choses à venir. 148

Figure 3. Proprotéine convertase subtilisine kexine 9 (PCSK9) : de la découverte à la clinique. Le rythme de la recherche, de la découverte de PCSK9 aux essais cliniques, a été rapide depuis sa découverte en 2003 et la preuve de principe que l'anticorps monoclonal (mAb) peut inhiber sa fonction en 2010, jusqu'aux essais cliniques de phase III en cours. CVD indique une maladie cardiovasculaire FH, hypercholestérolémie familiale GOF, gain de fonction KO, knock-out LDL-C, lipoprotéine de basse densité-cholestérol LDLR, récepteur LDL LOF, perte de fonction et NARC, convertase régulée par l'apoptose neurale.


Amériques

Le site sera affiché en anglais.

Nous utilisons ces cookies pour garantir que notre site fonctionne correctement et en toute sécurité, ils sont nécessaires au fonctionnement de nos services et ne peuvent pas être désactivés dans nos systèmes. Ils ne sont généralement définis qu'en réponse à des actions de votre part qui équivalent à une demande de services, telles que la connexion, l'utilisation d'un panier ou le remplissage de formulaires. Vous pouvez configurer votre navigateur pour bloquer ou vous alerter sur ces cookies, mais certaines parties de nos services ne fonctionneront pas sans eux. Comme les autres cookies que nous utilisons, les cookies strictement nécessaires peuvent être des cookies internes ou des cookies tiers.

Nous utilisons ces cookies pour mémoriser vos paramètres et préférences. Par exemple, nous pouvons utiliser ces cookies pour mémoriser vos préférences linguistiques.
Autoriser les cookies de préférence

Nous utilisons ces cookies pour collecter des informations sur la façon dont vous interagissez avec nos services et pour nous aider à les mesurer et à les améliorer. Par exemple, nous pouvons utiliser ces cookies pour déterminer si vous avez interagi avec une certaine page.
Autoriser les cookies de performance/statistiques

Nous et nos partenaires publicitaires utilisons ces cookies pour diffuser des publicités, pour les rendre plus pertinentes et significatives pour vous, et pour suivre l'efficacité de nos campagnes publicitaires, à la fois sur nos services et sur d'autres sites Web et réseaux sociaux.
Autoriser les cookies marketing


Introduction

Caenorhabditis elegans est un système modèle important en biologie, en raison de sa taille traitable (959 cellules somatiques chez les hermaphrodites adultes), de sa manipulabilité génétique et de sa transparence optique, qui permet d'obtenir une imagerie de l'organisme entier des processus et signaux biologiques. Il n'est donc pas surprenant que la microscopie à super-résolution ait été utile à l'analyse de C. elegans, avec des études appliquant STORM, PALM, SR-SIM et STED à C. elegans pour étudier les cellules et les tissus intacts ou disséqués C. elegans (Rankin et al., 2011 Gao et al., 2012 Vangindertael et al., 2015 He et al., 2016 Köhler et al., 2017 Krieg et al., 2017). Cependant, les profondeurs d'imagerie de ces études étaient en grande partie physiquement limitées à quelques microns à plusieurs dizaines de microns, insuffisantes pour cartographier toute la profondeur d'un animal adulte, et le matériel requis pour la microscopie à super-résolution n'est pas disponible dans tous les laboratoires, et peut être lent et/ou coûteux à déployer. De plus, la cuticule dure de C. elegans présente une barrière à l'immunocoloration chez l'animal intact, importante pour l'imagerie STORM et STED et pour le marquage général des protéines dans divers contextes scientifiques.

Récemment, nous avons découvert qu'il est possible d'étendre de manière isotrope des spécimens biologiques en les imprégnant uniformément et de manière dense avec un réseau de polymère hydrogel gonflable, en ancrant des biomolécules ou des marqueurs clés dans l'hydrogel, en ramollissant le tissu par un processus chimique, puis en ajoutant de l'eau, qui gonfle le polymère et à son tour le tissu (Chen et al., 2015). Cette technique, la microscopie à expansion (ExM), est maintenant adaptée et améliorée par de nombreux groupes, et a été appliquée aux tissus de souris, de patients humains et dans de nombreux autres contextes biologiques (Chen et al., 2015 Chen et al., 2016 Chozinski et al., 2016 Ku et al., 2016 Tillberg et al., 2016 Chang et al., 2017 Zhao et al., 2017 Park, 2018 Truckenbrodt et al., 2018 Gambarotto et al., 2019 Wassie et al., 2019). Cependant, C. elegans est enveloppé dans une cuticule multicouche, qui est bien connue pour être imperméable à de nombreuses petites molécules et à tous les anticorps, et mécaniquement rigide au point où l'on s'attendrait à ce que l'expansion physique se déroule mal (Duerr, 2006 Page et Johnstone, 2007 Chisholm et Xu, 2012). Ainsi, nous avons entrepris de développer un protocole ExM personnalisé pour le C. elegans contexte qui permettrait de surmonter ces obstacles.

Pour atteindre cet objectif, nous avons modifié les protocoles précédemment publiés de plusieurs manières (Figure 1, étapes vertes) pour générer un nouveau protocole que nous appelons expansion de C. elegans (ou Excel). Ce protocole se traduit par une coloration élevée des anticorps signal-arrière-plan contre les protéines fluorescentes résistantes aux protéases, à faible distorsion (

1 à 6 % sur des échelles de longueur de 0 à 100 m) expansion physique par

3,3x, et détection à la fois des protéines et de l'ARN avec une résolution sous-cellulaire. En utilisant ExCel, nous avons pu mieux résoudre les protéines synaptiques et de jonction lacunaire qu'avec la microscopie confocale ordinaire, et simultanément imager les protéines, l'ARN et l'emplacement de l'ADN dans le même échantillon. En particulier, une telle capacité multiplexée n'a pas été démontrée avec les méthodes de super-résolution précédentes dans C. elegans, et facilite les analyses précises à l'échelle nanométrique de la façon dont plusieurs types moléculaires sont organisés spatialement dans le contexte d'un animal entier.

Flux de travail pour l'expansion de C. elegans (ExCel) traitement des échantillons.

Une méthode pour étendre la cuticule intacte C. elegans, étendant les protocoles proExM et ExFISH publiés avec des modifications spécifiques (affichées en texte vert, touche complète en bas à gauche). Selon que l'utilisateur a l'intention de visualiser ou non des ARN, le protocole se ramifie en deux formes. Le protocole sans ExFISH, qui prend en charge la lecture des protéines fluorescentes, la localisation de l'ADN (sous forme de coloration DAPI) et les caractéristiques anatomiques, est indiqué par des flèches bleues, se terminant par le panneau L. Le protocole avec ExFISH, qui prend également en charge la lecture des ARN , est indiqué par des flèches orange, se terminant par le panneau Q. Pour toutes les étapes après la formation d'hydrogel (panneaux GQ), le facteur d'expansion linéaire du composite hydrogel-échantillon est indiqué entre parenthèses. (A–Q) Étapes du protocole, avec le texte en gras indiquant le titre de l'étape voir le texte pour les détails de chaque étape.

Le protocole ExCel standard visualise des reporters fluorescents, tels que ceux fusionnés à des protéines d'intérêt, ce qui nécessite une transgénèse et pourrait en principe affecter la fonction et la localisation de la protéine cible. Ainsi, nous avons également développé un protocole ExCel alternatif, que nous appelons ExCel préservant l'épitope, qui permet la détection de protéines totalement endogènes non étiquetées, à l'aide d'anticorps primaires prêts à l'emploi. Le protocole ExCel préservant les épitopes remplace l'utilisation de la protéase K, une protéase générale qui perturbe la plupart des épitopes dans le protocole ExCel standard, par un traitement de perméabilisation des cuticules préservant les épitopes que nous avons identifié dans un criblage systématique de traitements chimiques. Ce protocole permet la coloration des anticorps des épitopes protéiques au détriment d'un facteur d'expansion légèrement réduit (

2,8x) et une isotropie d'expansion inférieure (

Erreur de 8 à 25 % sur des échelles de longueur de 0 à 100 m). Nous avons montré qu'ExCel préservant les épitopes permet une lecture multiplexée de plusieurs protéines natives à super-résolution, une capacité que nous avons utilisée pour identifier une localisation de protéine non signalée auparavant aux jonctions entre les cellules précurseurs vulvaires en développement, et pour résoudre les zones péri-actives et actives des pré-synapses chimiques.

Enfin, nous avons développé un troisième protocole, itératif ExCel (iExCel), qui permet deux cycles successifs d'expansion médiée par un hydrogel d'un ver donné, en incorporant les stratégies précédemment validées de microscopie à expansion itérative dans le contexte ExCel (Chang et al., 2017 ). iExCel apporte le facteur d'expansion de

20x, et la limite théorique de résolution jusqu'à

25 nm, à un faible niveau de distorsion (

1,5 à 4,5% sur des échelles de longueur de 0 à 100 m), à égalité avec celle de l'ExCel standard, sur lequel il s'appuie. Avec iExCel, nous avons pu résoudre les points fluorescents pouvant représenter des molécules individuelles de GFP exprimées dans le cytosol neuronal.

Chacun de ces protocoles ExCel met en évidence certains des défis qui subsistent dans le déploiement d'ExM dans C. elegans, y compris la distorsion dans les régions des gonades et de la bouche, une isotropie générale réduite avec ExCel préservant les épitopes et la capacité de détecter uniquement les protéines fluorescentes avec la forme actuelle d'iExCel, ce qui constitue une base pour une optimisation supplémentaire à l'avenir.


Résumé

L'effet régulateur de l'hormone de croissance (GH) sur ses cellules cibles est médié par le récepteur GH (GHR). La liaison de la GH au GHR entraîne la formation d'un GH-(GHR)2 complexe et l'initiation de cascades de transduction de signal via l'activation de la tyrosine kinase JAK2. L'endocytose et le transport ultérieurs vers le lysosome du complexe ligand-récepteur sont régulés via le système ubiquitine et nécessitent la présence d'un motif intact d'endocytose dépendante de l'ubiquitine (UbE) dans la queue cytosolique du GHR. Récemment, le modèle de dimérisation des récepteurs induite par un ligand a été contesté. Dans cette étude, la dimérisation du GHR indépendante du ligand est démontrée dans le réticulum endoplasmique et à la surface cellulaire par co-immunoprécipitation d'un GHR tronqué à marquage épitopique avec le GHR de type sauvage. De plus, des preuves sont fournies que le domaine extracellulaire du GHR n'est pas requis pour maintenir cette interaction. L'internalisation d'un récepteur chimérique, qui ne parvient pas à se dimériser, est indépendante d'un motif UbE intact. Par conséquent, nous postulons que la dimérisation des molécules de GHR est nécessaire pour l'endocytose dépendante du système ubiquitine.

La croissance postnatale ainsi que le métabolisme des lipides et des glucides sont régulés par l'hormone de croissance (GH). Les effets de la GH sont médiés par le récepteur GH (GHR), une glycoprotéine transmembranaire de type I qui appartient à la superfamille des récepteurs des cytokines. En plus du GHR, cette famille comprend les récepteurs de l'érythropoïétine (Epo), de la prolactine, de la thrombopoïétine, de la leptine, du facteur neurotrophique ciliaire, du facteur inhibiteur de la leucémie, du facteur de stimulation des colonies de granulocytes et plusieurs des IL (1). Bien que l'homologie globale entre les membres soit limitée, certains motifs conservés ont été identifiés (examinés dans la référence 2). Leur domaine extracellulaire contient des paires de résidus cystéine liés par un disulfure et un motif WSXWS (tryptophane, sérine, tout acide aminé, tryptophane, sérine), qui est indirectement impliqué dans la liaison du ligand (3). Tous les récepteurs de cytokines sont dépourvus d'activité kinase intrinsèque. Au lieu de cela, un domaine riche en proline conservé dans leur queue cytosolique, boîte 1, fonctionne comme un site de liaison pour les membres de la famille des tyrosine kinase JAK. Dans le cas du GHR, la liaison du ligand entraîne l'activation des molécules JAK2 (4), qui à leur tour phosphorylent les résidus tyrosine dans la queue cytosolique du récepteur et les molécules de signalisation en aval (examinées dans la référence 5). Le complexe ligand-récepteur est internalisé via des vésicules recouvertes de clathrine et ensuite transporté via des endosomes vers des lysosomes (6&# x020138). Nous avons montré que l'endocytose et le transport vers les lysosomes nécessitent un système actif de conjugaison d'ubiquitine et peuvent être inhibés par des inhibiteurs de protéasome (9&# x0201311). En particulier, un motif de 10 acides aminés - le motif d'endocytose dépendante de la bubiquitine (UbE), DSWVEFIELD dans la queue cytosolique du GHR est essentiel car les mutations ici, par exemple F327A, inhibent l'ubiquitination, l'internalisation et la dégradation du GHR ( 10, 12).

Sur la base des données cristallographiques de la GH liée aux domaines extracellulaires du GHR, il a été postulé qu'une seule molécule de GH dimérise deux molécules de GHR après quoi la signalisation est initiée (3, 13). Cependant, la dimérisation elle-même n'est pas suffisante pour la transduction du signal car l'administration d'AcM dirigés vers le domaine extracellulaire du GHR a entraîné des GHR dimérisés mais n'a pas réussi à induire la transduction du signal (14). Le domaine extracellulaire GHR contient deux sous-domaines, qui sont séparés par une région charnière (3). Avec un Ab levé contre cette région charnière, Mellado et al. (15) ont démontré un changement de conformation après la liaison au ligand. La reconnaissance du GHR par cet Ab s'est améliorée après la liaison de la GH mais pas lorsque l'antagoniste de la GH GH(G120R), avec un seul site de liaison du GHR intact, a été utilisé (15). Récemment, Ross et al. (16) ont utilisé le mAb Mab5, qui a été postulé pour interférer avec la dimérisation du GHR, et a démontré une augmentation du nombre de sites de liaison pour la GH ainsi que l'antagoniste de la GH B2036, qui contient également un site de liaison GHR défectueux. Cela suggère que B2036 se lie à un dimère de récepteur préformé (16). Des preuves supplémentaires ont été fournies par des études de réticulation avec de la GH ou un antagoniste de la GH marqué au 125I. Des complexes de taille similaire et correspondant à une stoechiométrie ligand:GHR de 1:2 ont été détectés pour les deux ligands (17, 18). Prises ensemble, ces données prédisent la présence de dimères de GHR préformés à la surface cellulaire, comme cela a également été récemment proposé pour le récepteur Epo (EpoR) sur la base de données cristallographiques (19, 20) et d'un copatching par immunofluorescence médiée par Ab d'EpoR marqués par des épitopes (21 ).

Ici, nous montrons que le GHR est dimérisé en l'absence de ligand dans le réticulum endoplasmique (RE) et à la surface cellulaire. Nos données suggèrent que le domaine extracellulaire du GHR n'est pas essentiel au maintien de cette interaction. L'internalisation d'une protéine chimérique, qui ne parvient pas à se dimériser, est indépendante d'un motif UbE intact, suggérant que la dimérisation est une condition préalable à l'endocytose dépendante du système ubiquitine.


RLES ÉMERGENTS POUR LES PROTÉASES À CYSTEINE EN BIOLOGIE HUMAINE

RésuméLes protéases à cystéine ont traditionnellement été considérées comme des médiateurs lysosomal de la dégradation terminale des protéines. Cependant, des découvertes récentes réfutent ce point de vue limité et suggèrent un rôle plus étendu des protéases à cystéine en biologie humaine. Plusieurs membres nouvellement découverts de cette classe d'enzymes sont des protéases régulées avec une expression tissulaire limitée, ce qui implique des rôles spécifiques dans la physiologie cellulaire. Ces rôles semblent inclure l'apoptose, les réponses immunitaires du CMH de classe II, le traitement des prohormones et le remodelage de la matrice extracellulaire important pour le développement osseux. La capacité des macrophages et d'autres cellules à mobiliser des protéases à cystéine élastolytiques à leurs surfaces dans des conditions spécialisées peut également conduire à une dégradation accélérée du collagène et de l'élastine aux sites d'inflammation dans des maladies telles que l'athérosclérose et l'emphysème. Le développement d'inhibiteurs de protéases à cystéine spécifiques promet de fournir de nouveaux médicaments pour modifier l'immunité, l'ostéoporose et l'inflammation chronique.